close

SimulationCraft 715-02

for World of Warcraft 7.1.5 Live (wow build level 23360, git build c8f3bd3)

Current simulator hotfixes

Death Knight

Tag Spell / Effect Field Hotfixed Value DBC Value
2017-01-10 Portal to the Underworld damage increased by 33%.
Dragged to Helheim (effect#1) ap_coefficient 1.60 1.20

Druid

Tag Spell / Effect Field Hotfixed Value DBC Value
2016-12-18 Incorrect spell level for starfall damage component.
Starfall spell_level 40.00 76.00

Hunter

Tag Spell / Effect Field Hotfixed Value DBC Value
2017-1-8 Spelldata claims that Marking Target's rppm was buffed from 5 to 6.5, but testing shows higher.
Hunter's Mark rppm 7.20 6.50

Mage

Tag Spell / Effect Field Hotfixed Value DBC Value
2017-01-11 Incorrect spell level for Frozen Orb Bolt.
Frozen Orb spell_level 57.00 81.00

Mark of the Distant Army

Tag Spell / Effect Field Hotfixed Value DBC Value
2017-01-10 Set Velocity to a reasonable value.
Mark of the Distant Army prj_speed 40.00 1.00

Table of Contents

Raid Summary

 

Actions per Minute / DPS Variance Summary

Alythess' : 988793 dps, 579752 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
988792.8 988792.8 0.0 / 0.000% 0.0 / 0.0% 30.9
RPS Out RPS In Primary Resource Waiting APM Active Skill
26172.7 26172.7 Mana 0.00% 50.6 100.0% 100%
Talents
  • 15: Roaring Blaze (Destruction Warlock)
  • 30: Eradication (Destruction Warlock)
  • 60: Soul Harvest
  • 90: Grimoire of Service
  • 100: Wreak Havoc (Destruction Warlock)
  • Talent Calculator
Artifact

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Alythess' 988793
Chaos Bolt 323176 32.7% 58.4 5.01sec 1664731 1100346 Direct 111.4 0 872243 872243 100.0%  

Stats details: chaos_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 58.38 111.43 0.00 0.00 1.5129 0.0000 97190243.85 97190243.85 0.00 1100345.80 1100345.80
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 111.43 100.00% 872243.07 571126 1342604 872539.94 817114 925998 97190244 97190244 0.00
 
 

Action details: chaos_bolt

Static Values
  • id:116858
  • school:chromatic
  • resource:soul_shard
  • range:40.0
  • travel_speed:16.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:2.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:116858
  • name:Chaos Bolt
  • school:chromatic
  • tooltip:
  • description:Unleashes a devastating blast of chaos, causing {$s1=1} Chaos damage. Chaos Bolt always critically strikes and your critical strike chance increases its damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:4.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Conflagrate 107143 10.8% 48.4 6.21sec 665124 639769 Direct 96.2 190384 442388 334475 57.2%  

Stats details: conflagrate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 48.39 96.22 0.00 0.00 1.0396 0.0000 32184864.78 32184864.78 0.00 639769.11 639769.11
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 41.20 42.82% 190383.86 126130 296472 190489.76 167810 211509 7844651 7844651 0.00
crit 55.02 57.18% 442388.28 252261 707368 442505.36 392585 487100 24340213 24340213 0.00
 
 

Action details: conflagrate

Static Values
  • id:17962
  • school:fire
  • resource:chi
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:9.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.roaring_blaze.enabled&(charges=2+set_bonus.tier19_4pc|(charges>=1+set_bonus.tier19_4pc&recharge_time<gcd)|target.time_to_die<24)
Spelldata
  • id:17962
  • name:Conflagrate
  • school:fire
  • tooltip:
  • description:Triggers an explosion on the target, dealing {$s1=1} Fire damage.{$?s196406=false}[ Reduces the cast time of Incinerate and Chaos Bolt by {$117828s1=30}% for {$117828d=10 seconds}.][] |cFFFFFFFFGenerates 1 Soul Shard.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.265510
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Deadly Grace 5313 0.5% 14.3 2.08sec 110038 0 Direct 14.3 92279 184602 110034 19.2%  

Stats details: deadly_grace

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.26 14.26 0.00 0.00 0.0000 0.0000 1569335.72 1569335.72 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 11.52 80.76% 92279.09 81873 98248 92291.78 81873 98248 1062925 1062925 0.00
crit 2.74 19.24% 184602.08 163746 196496 174588.69 0 196496 506410 506410 0.00
 
 

Action details: deadly_grace

Static Values
  • id:188091
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:25.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188091
  • name:Deadly Grace
  • school:arcane
  • tooltip:
  • description:Deal {$s1=63339 to 95008} Arcane damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:63338.72
  • base_dd_max:95008.08
 
Immolate 234649 23.7% 19.9 15.27sec 3533873 3356624 Direct 38.6 131267 262509 198474 51.2%  
Periodic 293.5 141562 283103 214110 51.3% 195.9%

Stats details: immolate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 19.95 38.61 293.46 293.46 1.0528 2.0101 70495809.70 70495809.70 0.00 115397.78 3356623.64
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 18.84 48.79% 131267.03 87510 205603 131254.59 112087 150853 2472823 2472823 0.00
crit 19.77 51.21% 262508.61 175016 411302 262498.98 221571 303234 5189997 5189997 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 143.0 48.74% 141562.07 51 408702 141773.55 118752 165221 20249997 20249997 0.00
crit 150.4 51.26% 283103.21 100 817395 283534.43 245812 328295 42582993 42582993 0.00
 
 

Action details: immolate

Static Values
  • id:348
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:66000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.32
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:remains<=tick_time
Spelldata
  • id:348
  • name:Immolate
  • school:fire
  • tooltip:
  • description:Burns the enemy, causing {$s1=1} Fire damage immediately and an additional $157736o1 Fire damage over {$157736d=18 seconds}. |cFFFFFFFFPeriodic damage has a {$193541s1=15}% chance to generate 1 Soul Shard. Chance doubled on critical strikes.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.332000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.721500
  • base_td:0.00
  • dot_duration:18.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Incinerate 131856 13.4% 79.6 3.59sec 498520 404715 Direct 152.4 218230 436634 260364 19.3%  

Stats details: incinerate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 79.61 152.42 0.00 0.00 1.2318 0.0000 39685152.34 39685152.34 0.00 404715.14 404715.14
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 123.02 80.71% 218229.75 141453 332530 218284.45 206467 233363 26845707 26845707 0.00
crit 29.41 19.29% 436633.56 282912 665060 436766.35 381757 499599 12839445 12839445 0.00
 
 

Action details: incinerate

Static Values
  • id:29722
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:66000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:29722
  • name:Incinerate
  • school:fire
  • tooltip:
  • description:Draws fire toward the enemy, dealing {$s2=0} Fire damage.{$?s29722=true}|!c3[][ Replaces Shadow Bolt.]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.331000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Mark of the Hidden Satyr 8889 0.9% 19.9 14.99sec 134004 0 Direct 19.9 112356 224683 134005 19.3%  

Stats details: mark_of_the_hidden_satyr

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 19.95 19.95 0.00 0.00 0.0000 0.0000 2673083.59 2673083.59 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 16.10 80.73% 112355.70 107063 135251 112373.67 107063 123298 1809270 1809270 0.00
crit 3.84 19.27% 224682.94 214126 270502 220139.38 0 270502 863814 863814 0.00
 
 

Action details: mark_of_the_hidden_satyr

Static Values
  • id:191259
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191259
  • name:Mark of the Hidden Satyr
  • school:fire
  • tooltip:
  • description:Deals fire damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:2.500000
  • spell_power_mod.direct:2.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
pet - imp 42347 / 42347
Firebolt 42347 4.3% 108.8 2.77sec 117031 96094 Direct 107.9 98869 197791 117923 19.3%  

Stats details: firebolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 108.77 107.94 0.00 0.00 1.2179 0.0000 12729171.51 12729171.51 0.00 96093.88 96093.88
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 87.15 80.74% 98868.93 63168 119699 98895.32 96711 101173 8616728 8616728 0.00
crit 20.79 19.26% 197791.47 126337 239399 197839.30 180425 213453 4112443 4112443 0.00
 
 

Action details: firebolt

Static Values
  • id:3110
  • school:fire
  • resource:energy
  • range:40.0
  • travel_speed:16.0000
  • trigger_gcd:0.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.75
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:3110
  • name:Firebolt
  • school:fire
  • tooltip:
  • description:Deals {$s1=1} Fire damage to a target.$?a231795[ Damage increased by {$231795s1=50}% if you have Immolated the target.][] |cFF777777(Right-Click to toggle)|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
pet - service_imp 122888 / 39214
Firebolt 122888 4.0% 49.1 5.53sec 239147 209162 Direct 48.9 201660 403688 240540 19.2%  

Stats details: firebolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 49.14 48.86 0.00 0.00 1.1434 0.0000 11751963.91 11751963.91 0.00 209161.78 209161.78
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 39.45 80.75% 201660.07 126337 239399 201859.45 192282 209809 7956323 7956323 0.00
crit 9.40 19.25% 403688.01 252674 478798 404058.01 343561 478798 3795641 3795641 0.00
 
 

Action details: firebolt

Static Values
  • id:3110
  • school:fire
  • resource:energy
  • range:40.0
  • travel_speed:16.0000
  • trigger_gcd:0.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.75
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:3110
  • name:Firebolt
  • school:fire
  • tooltip:
  • description:Deals {$s1=1} Fire damage to a target.$?a231795[ Damage increased by {$231795s1=50}% if you have Immolated the target.][] |cFF777777(Right-Click to toggle)|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
pet - infernal 116151 / 9835
Immolation 90498 0.8% 1.0 0.00sec 2262549 0 Periodic 46.5 40783 81579 48616 19.2% 8.1%

Stats details: immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 23.27 46.54 0.0000 1.0463 2262548.58 2262548.58 0.00 92933.07 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 37.6 80.80% 40782.73 35222 42266 40787.12 39485 41863 1533522 1533522 0.00
crit 8.9 19.20% 81578.98 70443 84532 81587.02 70443 84532 729027 729027 0.00
 
 

Action details: immolation

Static Values
  • id:19483
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!ticking
Spelldata
  • id:19483
  • name:Immolation
  • school:fire
  • tooltip:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
 

Action details: immolation_tick

Static Values
  • id:20153
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all enemies near the caster.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
melee 25652 0.2% 22.0 1.11sec 29123 26434 Direct 22.0 24420 48861 29124 19.2%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.02 22.02 0.00 0.00 1.1018 0.0000 641331.59 942818.19 31.98 26433.58 26433.58
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 17.78 80.76% 24420.45 21063 25275 24420.12 23520 25275 434289 638446 31.98
crit 4.24 19.24% 48860.94 42125 50550 48429.33 0 50550 207043 304373 31.71
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
pet - doomguard 95463 / 8074
Doom Bolt 95463 0.8% 11.0 2.20sec 217911 101129 Direct 11.0 182571 365529 217930 19.3%  

Stats details: doom_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.95 10.95 0.00 0.00 2.1548 0.0000 2386652.80 2386652.80 0.00 101129.36 101129.36
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 8.84 80.68% 182571.11 176655 211986 182604.90 176655 211986 1613087 1613087 0.00
crit 2.12 19.32% 365528.54 353310 423973 330685.97 0 423973 773566 773566 0.00
 
 

Action details: doom_bolt

Static Values
  • id:85692
  • school:shadow
  • resource:energy
  • range:30.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:35.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:85692
  • name:Doom Bolt
  • school:shadow
  • tooltip:
  • description:Sends a shadowy bolt at the enemy, causing {$s1=1} Shadow damage. Deals {$s2=20}% additional damage to targets below 20% health.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
pet - lord_of_flames_infernal 116309 / 9849
Immolation 90652 0.8% 1.0 0.00sec 2266382 0 Periodic 46.5 40781 81596 48700 19.4% 8.1%

Stats details: immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 23.27 46.54 0.0000 1.0463 2266381.78 2266381.78 0.00 93090.52 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 37.5 80.60% 40780.67 35222 42266 40785.39 39624 41863 1529689 1529689 0.00
crit 9.0 19.40% 81596.00 70443 84532 81599.56 0 84532 736693 736693 0.00
 
 

Action details: immolation

Static Values
  • id:19483
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!ticking
Spelldata
  • id:19483
  • name:Immolation
  • school:fire
  • tooltip:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
 

Action details: immolation_tick

Static Values
  • id:20153
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all enemies near the caster.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
melee 25657 0.2% 22.0 1.11sec 29129 26439 Direct 22.0 24420 48866 29129 19.3%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.02 22.02 0.00 0.00 1.1018 0.0000 641455.87 943000.90 31.98 26438.71 26438.71
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 17.78 80.74% 24419.88 21063 25275 24419.99 23743 25275 434165 638263 31.98
crit 4.24 19.26% 48865.67 42125 50550 48475.52 0 50550 207291 304738 31.71
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
pet - lord_of_flames_infernal 116218 / 9841
Immolation 90568 0.8% 1.0 0.00sec 2264303 0 Periodic 46.5 40781 81591 48654 19.3% 8.1%

Stats details: immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 23.27 46.54 0.0000 1.0463 2264302.79 2264302.79 0.00 93005.13 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 37.6 80.71% 40781.32 35222 42266 40785.24 39582 42065 1531768 1531768 0.00
crit 9.0 19.29% 81590.75 70443 84532 81594.74 70443 84532 732535 732535 0.00
 
 

Action details: immolation

Static Values
  • id:19483
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!ticking
Spelldata
  • id:19483
  • name:Immolation
  • school:fire
  • tooltip:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
 

Action details: immolation_tick

Static Values
  • id:20153
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all enemies near the caster.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
melee 25650 0.2% 22.0 1.11sec 29120 26431 Direct 22.0 24423 48839 29120 19.2%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.02 22.02 0.00 0.00 1.1018 0.0000 641266.71 942722.81 31.98 26430.91 26430.91
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 17.78 80.76% 24423.04 21063 25275 24423.00 23655 25275 434354 638541 31.98
crit 4.24 19.24% 48839.23 42125 50550 48430.14 0 50550 206913 304182 31.71
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
pet - lord_of_flames_infernal 116217 / 9840
Immolation 90551 0.8% 1.0 0.00sec 2263873 0 Periodic 46.5 40783 81573 48645 19.3% 8.1%

Stats details: immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 23.27 46.54 0.0000 1.0463 2263873.05 2263873.05 0.00 92987.47 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 37.6 80.73% 40783.40 35222 42266 40787.93 39671 41905 1532197 1532197 0.00
crit 9.0 19.27% 81573.35 70443 84532 81592.71 70443 84532 731676 731676 0.00
 
 

Action details: immolation

Static Values
  • id:19483
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!ticking
Spelldata
  • id:19483
  • name:Immolation
  • school:fire
  • tooltip:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
 

Action details: immolation_tick

Static Values
  • id:20153
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all enemies near the caster.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
melee 25666 0.2% 22.0 1.11sec 29139 26448 Direct 22.0 24422 48850 29139 19.3%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.02 22.02 0.00 0.00 1.1018 0.0000 641677.90 943327.29 31.98 26447.86 26447.86
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 17.77 80.69% 24421.70 21063 25275 24421.77 23655 25275 433942 637937 31.98
crit 4.25 19.31% 48850.46 42125 50550 48376.42 0 50550 207735 305391 31.67
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
pet - shadowy_tear 121344 / 20601
Shadow Bolt 121344 2.1% 4.4 59.39sec 1407281 0 Periodic 48.3 107082 213972 127646 19.2% 19.8%

Stats details: shadow_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.38 0.00 48.58 48.33 0.0000 1.2284 6168770.96 6168770.96 0.00 103362.39 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 39.0 80.76% 107081.56 57 130050 106822.84 0 130050 4179388 4179388 0.00
crit 9.3 19.24% 213972.35 138 260101 212074.02 0 260101 1989383 1989383 0.00
 
 

Action details: shadow_bolt

Static Values
  • id:196657
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:196657
  • name:Shadow Bolt
  • school:shadow
  • tooltip:
  • description:Sends a shadowy bolt at the enemy, causing {$s1=1} Shadow damage.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:14.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
pet - chaos_tear 138384 / 9620
Chaos Bolt 138384 1.0% 4.4 59.83sec 657510 330864 Direct 4.4 0 662015 662015 100.0%  

Stats details: chaos_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.38 4.35 0.00 0.00 1.9873 0.0000 2881823.56 2881823.56 0.00 330863.78 330863.78
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 4.35 100.00% 662014.95 613993 775648 662202.93 0 775648 2881824 2881824 0.00
 
 

Action details: chaos_bolt

Static Values
  • id:215279
  • school:chromatic
  • resource:none
  • range:100.0
  • travel_speed:16.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:5.500
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:215279
  • name:Chaos Bolt
  • school:chromatic
  • tooltip:
  • description:Unleashes a devastating blast of chaos, causing {$s1=1} Chaos damage. Chaos Bolt always critically strikes and your critical strike chance increases its damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:5.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
pet - chaos_portal 248817 / 18889
Chaos Barrage 248817 1.9% 4.4 57.98sec 1275331 0 Periodic 155.0 30560 61118 36443 19.3% 8.0%

Stats details: chaos_barrage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.43 0.00 155.72 154.98 0.0000 0.1545 5647896.39 5647896.39 0.00 234781.19 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 125.1 80.75% 30559.57 125 35765 30505.75 0 35765 3824184 3824184 0.00
crit 29.8 19.25% 61117.80 257 71529 60998.39 0 71529 1823712 1823712 0.00
 
 

Action details: chaos_barrage

Static Values
  • id:187394
  • school:magic
  • resource:none
  • range:100.0
  • travel_speed:24.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:187394
  • name:Chaos Barrage
  • school:magic
  • tooltip:
  • description:Deals {$s1=1} Chaos damage.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:5.50
  • base_tick_time:0.25
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Simple Action Stats Execute Interval
Alythess'
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Alythess'
  • harmful:false
  • if_expr:
 
Berserking 2.1 180.66sec

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.07 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=15}%.
  • description:Increases your haste by {$s1=15}% for {$d=10 seconds}.
 
Dimensional Rift 13.1 23.36sec

Stats details: dimensional_rift

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.13 0.00 0.00 0.00 1.0117 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: dimensional_rift

Static Values
  • id:196586
  • school:none
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:45.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:charges=3
Spelldata
  • id:196586
  • name:Dimensional Rift
  • school:chaos
  • tooltip:
  • description:Rips a hole in time and space, opening a portal that damages your target.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Alythess'
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Alythess'
  • harmful:false
  • if_expr:
 
Havoc 14.9 20.91sec

Stats details: havoc

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.89 0.00 0.00 0.00 1.0682 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: havoc

Static Values
  • id:80240
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:88000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies>1&(active_enemies<4|talent.wreak_havoc.enabled&active_enemies<6)&!debuff.havoc.remains
Spelldata
  • id:80240
  • name:Havoc
  • school:shadow
  • tooltip:Spells cast by the Warlock also hit this target.
  • description:Marks a target with Havoc for {$d=8 seconds}, causing your single target spells to also strike the Havoc victim. Limit 1.
 
Life Tap 7.5 30.59sec

Stats details: life_tap

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.51 0.00 0.00 0.00 1.0489 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: life_tap

Static Values
  • id:1454
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.empowered_life_tap.enabled&!buff.empowered_life_tap.remains
Spelldata
  • id:1454
  • name:Life Tap
  • school:shadow
  • tooltip:
  • description:Restores {$s1=30}% of your maximum mana, at the cost of {$s2=10}% of your maximum health.
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Grimoire: Imp (service_imp) 3.7 91.80sec

Stats details: service_imp

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.68 0.00 0.00 0.00 0.9719 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: service_imp

Static Values
  • id:111859
  • school:shadow
  • resource:soul_shard
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:90.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:111859
  • name:Grimoire: Imp
  • school:shadow
  • tooltip:
  • description:Summons an Imp who attacks the target for {$108501s1=25} sec. Imps cast ranged Firebolts and cleanse a hostile magic effect from their master.
 
Soul Harvest 2.9 120.91sec

Stats details: soul_harvest

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.90 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: soul_harvest

Static Values
  • id:196098
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:196098
  • name:Soul Harvest
  • school:shadow
  • tooltip:Damage increased by {$s1=20}%.
  • description:Increases your damage and your pets' damage by {$s1=20}%. Lasts {$d=15 seconds}, increased by {$s2=2} sec for each target afflicted by your {$?s137043=false}[Agony][]{$?s137044=false}[Doom][]{$?s137046=false}[Immolate][], up to a maximum of {$s3=35} sec.
 
Summon Doomguard 1.0 0.00sec

Stats details: summon_doomguard

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 1.0805 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_doomguard

Static Values
  • id:18540
  • school:shadow
  • resource:soul_shard
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.grimoire_of_supremacy.enabled&active_enemies=1&artifact.lord_of_flames.rank=0
Spelldata
  • id:18540
  • name:Summon Doomguard
  • school:shadow
  • tooltip:
  • description:Summons a Doomguard for {$60478d=25 seconds} to assault the target with its Doom Bolts.
 
Summon Imp 1.0 0.00sec

Stats details: summon_imp

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_imp

Static Values
  • id:688
  • school:shadow
  • resource:soul_shard
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!talent.grimoire_of_supremacy.enabled&(!talent.grimoire_of_sacrifice.enabled|buff.demonic_power.down)
Spelldata
  • id:688
  • name:Summon Imp
  • school:shadow
  • tooltip:
  • description:Summons an Imp under your command that casts ranged Firebolts.$?s74434[ |cFFFFFFFFSoulburn:|r |cFF8282FFInstant cast.|r][]
 
Summon Infernal 1.0 0.00sec

Stats details: summon_infernal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.7577 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_infernal

Static Values
  • id:1122
  • school:shadow
  • resource:soul_shard
  • range:30.0
  • travel_speed:1.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.grimoire_of_supremacy.enabled&artifact.lord_of_flames.rank>0
Spelldata
  • id:1122
  • name:Summon Infernal
  • school:shadow
  • tooltip:
  • description:Summons an Infernal from the Twisting Nether, impacting for {$22703s1=0} Fire damage and stunning all enemy targets in the area for {$22703d=2 seconds}. The Infernal will serve you for {$111685d=25 seconds}, dealing strong area-of-effect damage.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Accelerando 20.1 0.0 15.4sec 15.4sec 78.51% 78.51% 1.4(1.4) 19.3

Buff details

  • buff initial source:Alythess'
  • cooldown name:buff_accelerando
  • max_stacks:5
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:734.41

Stack Uptimes

  • accelerando_1:29.79%
  • accelerando_2:24.56%
  • accelerando_3:14.68%
  • accelerando_4:6.56%
  • accelerando_5:2.92%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225719
  • name:Accelerando
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc225125=Your damaging spells have a chance to grant you {$225719s1=528} Haste for {$225719d=12 seconds}, stacking up to 5 times. Stacking does not refresh duration.}
  • max_stacks:5
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Berserking 2.1 0.0 180.7sec 180.7sec 6.87% 8.45% 0.0(0.0) 2.0

Buff details

  • buff initial source:Alythess'
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:10.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • berserking_1:6.87%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=15}%.
  • description:Increases your haste by {$s1=15}% for {$d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.55% 15.51% 0.0(0.0) 1.0

Buff details

  • buff initial source:Alythess'
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:13.55%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Conflagration of Chaos 24.2 0.0 12.3sec 12.3sec 49.11% 46.99% 0.0(0.0) 1.0

Buff details

  • buff initial source:Alythess'
  • cooldown name:buff_conflagration_of_chaos
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:50.00%
  • default_value:-0.00

Stack Uptimes

  • conflagration_of_chaos_1:49.11%

Trigger Attempt Success

  • trigger_pct:50.02%

Spelldata details

  • id:196546
  • name:Conflagration of Chaos
  • tooltip:Your {$?s17877=false}[Shadowburn][Conflagrate] will always critically strike. Critical strike chance will increase the critical strike damage of {$?s17877=false}[Shadowburn][Conflagrate].
  • description:{$@spelldesc219195={$?s17877=false}[Shadowburn][Conflagrate] has a chance to guarantee your next {$?s17877=false}[Shadowburn][Conflagrate] critically strikes, and to increase its damage by your critical strike chance.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Devil's Due 3.4 0.0 70.0sec 70.0sec 8.67% 10.22% 0.0(0.0) 3.2

Buff details

  • buff initial source:Alythess'
  • cooldown name:buff_devils_due
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.18

Stack Uptimes

  • devils_due_1:8.67%

Trigger Attempt Success

  • trigger_pct:99.95%

Spelldata details

  • id:225776
  • name:Devil's Due
  • tooltip:Cast speed slowed by {$s1=7}%.
  • description:{$@spelldesc225142=Your damaging spells have a chance to grant Nefarious Pact, increasing your casting speed by {$225774s1=17}% for {$225774d=12 seconds}. When Nefarious Pact expires, your casting speed is decreased by {$225776s1=7}% for {$225776d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Embrace Chaos 26.2 33.2 11.7sec 5.0sec 59.91% 67.42% 33.2(33.2) 25.6

Buff details

  • buff initial source:Alythess'
  • cooldown name:buff_embrace_chaos
  • max_stacks:1
  • duration:4.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • embrace_chaos_1:59.91%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:212019
  • name:Embrace Chaos
  • tooltip:Chaos Bolt has {$s1=40}% reduced cast time.
  • description:{$@spelldesc212018=Casting Chaos Bolt reduces the cast time of your next Chaos Bolt by {$212019s1=40}% for {$212019d=4 seconds}.}
  • max_stacks:0
  • duration:4.00
  • cooldown:0.00
  • default_chance:0.00%
Lord of Flames 1.0 0.0 0.0sec 0.0sec 97.88% 97.88% 0.0(0.0) 0.0

Buff details

  • buff initial source:Alythess'
  • cooldown name:buff_lord_of_flames
  • max_stacks:1
  • duration:600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • lord_of_flames_1:97.88%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:226802
  • name:Lord of Flames
  • tooltip:Recently activated Lord of Flames.
  • description:{$@spelldesc224103=Once every {$s2=10} minutes, {$?s152107=false}[your Infernal's Meteor Strike][Summon Infernal] will summon {$s3=3} additional Infernals to serve you for {$226804d=25 seconds}.}
  • max_stacks:0
  • duration:600.00
  • cooldown:0.00
  • default_chance:0.00%
Nefarious Pact 3.4 0.0 70.3sec 69.4sec 13.48% 14.96% 0.0(0.0) 3.3

Buff details

  • buff initial source:Alythess'
  • cooldown name:buff_nefarious_pact
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.44

Stack Uptimes

  • nefarious_pact_1:13.48%

Trigger Attempt Success

  • trigger_pct:99.95%

Spelldata details

  • id:225774
  • name:Nefarious Pact
  • tooltip:Cast speed increased by {$s1=17}%.
  • description:{$@spelldesc225142=Your damaging spells have a chance to grant Nefarious Pact, increasing your casting speed by {$225774s1=17}% for {$225774d=12 seconds}. When Nefarious Pact expires, your casting speed is decreased by {$225776s1=7}% for {$225776d=8 seconds}.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of Deadly Grace 1.0 0.0 0.0sec 0.0sec 10.16% 10.16% 0.0(0.0) 1.0

Buff details

  • buff initial source:Alythess'
  • cooldown name:buff_potion_of_deadly_grace
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_deadly_grace_1:10.16%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188027
  • name:Potion of Deadly Grace
  • tooltip:Your attacks have a chance to unleash a bolt of energy at your target.
  • description:Grants your attacks a chance to unleash a bolt of energy at your target. Staying away from enemies for the entire duration of the effect will extend the effect by an additional 5 seconds.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
Potion of Prolonged Power 1.0 0.0 0.0sec 0.0sec 19.64% 19.64% 0.0(0.0) 1.0

Buff details

  • buff initial source:Alythess'
  • cooldown name:buff_potion_of_prolonged_power
  • max_stacks:1
  • duration:60.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:all
  • amount:2500.00

Stack Uptimes

  • potion_of_prolonged_power_1:19.64%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:229206
  • name:Potion of Prolonged Power
  • tooltip:All stats increased by {$s1=2500}.
  • description:Drink to increase all stats by {$s1=2500} for {$d=60 seconds}.
  • max_stacks:0
  • duration:60.00
  • cooldown:1.00
  • default_chance:0.00%
Soul Harvest 2.9 0.0 120.9sec 120.9sec 17.76% 17.76% 0.0(0.0) 2.7

Buff details

  • buff initial source:Alythess'
  • cooldown name:buff_soul_harvest
  • max_stacks:1
  • duration:15.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • soul_harvest_1:17.76%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:196098
  • name:Soul Harvest
  • tooltip:Damage increased by {$s1=20}%.
  • description:Increases your damage and your pets' damage by {$s1=20}%. Lasts {$d=15 seconds}, increased by {$s2=2} sec for each target afflicted by your {$?s137043=false}[Agony][]{$?s137044=false}[Doom][]{$?s137046=false}[Immolate][], up to a maximum of {$s3=35} sec.
  • max_stacks:0
  • duration:15.00
  • cooldown:120.00
  • default_chance:0.00%
Constant Buffs
Well Fed (azshari_salad)

Buff details

  • buff initial source:Alythess'
  • cooldown name:buff_azshari_salad
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:375.00

Stack Uptimes

  • azshari_salad_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225603
  • name:Well Fed
  • tooltip:Haste increased by $w1.
  • description:Increases haste by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Defiled Augmentation

Buff details

  • buff initial source:Alythess'
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Whispered Pact

Buff details

  • buff initial source:Alythess'
  • cooldown name:buff_flask_of_the_whispered_pact
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:1300.00

Stack Uptimes

  • flask_of_the_whispered_pact_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188031
  • name:Flask of the Whispered Pact
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%

Procs

Count Interval
shadowy_tear 4.3 59.1sec
chaos_tear 4.4 59.2sec
chaos_portal 4.4 59.0sec
dimension_ripper 4.0 54.4sec

Resources

Resource Usage Type Count Total Average RPE APR
Alythess'
chaos_bolt Soul Shard 59.4 118.8 2.0 2.0 818349.3
havoc Mana 14.9 1310578.0 88000.0 88000.3 0.0
immolate Mana 19.9 1316588.8 66000.0 65999.1 53.5
incinerate Mana 79.6 5253964.2 66000.0 65999.6 7.6
service_imp Soul Shard 3.7 3.7 1.0 1.0 0.0
summon_doomguard Soul Shard 1.0 1.0 1.0 1.0 0.0
summon_infernal Soul Shard 1.0 1.0 1.0 1.0 0.0
pet - imp
firebolt Energy 108.8 4350.7 40.0 40.0 2925.8
pet - service_imp
firebolt Energy 49.1 1965.7 40.0 40.0 5978.5
pet - doomguard
doom_bolt Energy 11.0 383.3 35.0 35.0 6226.0
Resource Gains Type Count Total Average Overflow
life_tap Mana 7.51 2478348.50 (35.32%) 330000.00 0.00 0.00%
immolate Soul Shard 66.46 65.88 (53.51%) 0.99 0.58 0.88%
conflagrate Soul Shard 48.39 48.33 (39.26%) 1.00 0.05 0.11%
mp5_regen Mana 476.44 4538649.13 (64.68%) 9526.20 89766.33 1.94%
soulsnatcher Soul Shard 8.90 8.90 (7.23%) 1.00 0.00 0.00%
pet - imp
energy_regen Energy 1900.91 4184.46 (100.00%) 2.20 21.57 0.51%
pet - service_imp
energy_regen Energy 442.76 1345.02 (100.00%) 3.04 61.69 4.39%
pet - doomguard
energy_regen Energy 15.89 342.23 (100.00%) 21.53 42.70 11.09%
Resource RPS-Gain RPS-Loss
Health 0.00 7855.04
Mana 23302.99 26172.70
Soul Shard 0.41 0.41
Combat End Resource Mean Min Max
Mana 236791.96 1745.82 482930.38
Soul Shard 1.67 0.00 5.00

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 1.4%

Statistics & Data Analysis

Fight Length
Sample Data Alythess' Fight Length
Count 9999
Mean 301.12
Minimum 221.26
Maximum 379.15
Spread ( max - min ) 157.89
Range [ ( max - min ) / 2 * 100% ] 26.22%
DPS
Sample Data Alythess' Damage Per Second
Count 9999
Mean 988792.81
Minimum 875403.18
Maximum 1132584.94
Spread ( max - min ) 257181.76
Range [ ( max - min ) / 2 * 100% ] 13.00%
Priority Target DPS
Sample Data Alythess' Priority Target Damage Per Second
Count 9999
Mean 579751.92
Minimum 515566.02
Maximum 676203.29
Spread ( max - min ) 160637.26
Range [ ( max - min ) / 2 * 100% ] 13.85%
DPS(e)
Sample Data Alythess' Damage Per Second (Effective)
Count 9999
Mean 988792.81
Minimum 875403.18
Maximum 1132584.94
Spread ( max - min ) 257181.76
Range [ ( max - min ) / 2 * 100% ] 13.00%
Damage
Sample Data Alythess' Damage
Count 9999
Mean 243798489.98
Minimum 172657320.71
Maximum 322865198.07
Spread ( max - min ) 150207877.36
Range [ ( max - min ) / 2 * 100% ] 30.81%
DTPS
Sample Data Alythess' Damage Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Alythess' Healing Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS(e)
Sample Data Alythess' Healing Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Alythess' Heal
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Alythess' Healing Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Alythess' Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
ETMI
Sample Data Alythess'Theck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data Alythess' Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=whispered_pact
1 0.00 food,type=azshari_salad
2 0.00 summon_pet,if=!talent.grimoire_of_supremacy.enabled&(!talent.grimoire_of_sacrifice.enabled|buff.demonic_power.down)
3 0.00 summon_infernal,if=talent.grimoire_of_supremacy.enabled&artifact.lord_of_flames.rank>0
4 0.00 summon_infernal,if=talent.grimoire_of_supremacy.enabled&active_enemies>1
5 0.00 summon_doomguard,if=talent.grimoire_of_supremacy.enabled&active_enemies=1&artifact.lord_of_flames.rank=0
6 0.00 augmentation,type=defiled
7 0.00 snapshot_stats
8 0.00 grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
9 0.00 life_tap,if=talent.empowered_life_tap.enabled&!buff.empowered_life_tap.remains
A 0.00 potion,name=prolonged_power
B 0.00 chaos_bolt
Default action list Executed every time the actor is available.
# count action,conditions
C 14.89 havoc,target=2,if=active_enemies>1&(active_enemies<4|talent.wreak_havoc.enabled&active_enemies<6)&!debuff.havoc.remains
D 1.00 dimensional_rift,if=charges=3
E 10.31 immolate,if=remains<=tick_time
F 0.63 immolate,cycle_targets=1,if=active_enemies>1&remains<=tick_time&(!talent.roaring_blaze.enabled|(!debuff.roaring_blaze.remains&action.conflagrate.charges<2))
G 9.04 immolate,if=talent.roaring_blaze.enabled&remains<=duration&!debuff.roaring_blaze.remains&target.time_to_die>10&(action.conflagrate.charges=2+set_bonus.tier19_4pc|(action.conflagrate.charges>=1+set_bonus.tier19_4pc&action.conflagrate.recharge_time<cast_time+gcd)|target.time_to_die<24)
H 2.07 berserking
0.00 blood_fury
0.00 arcane_torrent
I 1.00 potion,name=deadly_grace,if=(buff.soul_harvest.remains|trinket.proc.any.react|target.time_to_die<=45)
0.00 shadowburn,if=buff.conflagration_of_chaos.remains<=action.chaos_bolt.cast_time
0.00 shadowburn,if=(charges=1&recharge_time<action.chaos_bolt.cast_time|charges=2)&soul_shard<5
J 13.88 conflagrate,if=talent.roaring_blaze.enabled&(charges=2+set_bonus.tier19_4pc|(charges>=1+set_bonus.tier19_4pc&recharge_time<gcd)|target.time_to_die<24)
K 34.51 conflagrate,if=talent.roaring_blaze.enabled&debuff.roaring_blaze.stack>0&dot.immolate.remains>dot.immolate.duration*0.3&(active_enemies=1|soul_shard<3)&soul_shard<5
0.00 conflagrate,if=!talent.roaring_blaze.enabled&!buff.backdraft.remains&buff.conflagration_of_chaos.remains<=action.chaos_bolt.cast_time
0.00 conflagrate,if=!talent.roaring_blaze.enabled&!buff.backdraft.remains&(charges=1&recharge_time<action.chaos_bolt.cast_time|charges=2)&soul_shard<5
0.00 life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<=gcd
0.00 dimensional_rift,if=equipped.144369&!buff.lessons_of_spacetime.remains&((!talent.grimoire_of_supremacy.enabled&!cooldown.summon_doomguard.remains)|(talent.grimoire_of_service.enabled&!cooldown.service_pet.remains)|(talent.soul_harvest.enabled&!cooldown.soul_harvest.remains))
L 3.68 service_pet
M 1.00 summon_infernal,if=artifact.lord_of_flames.rank>0&!buff.lord_of_flames.remains
N 1.00 summon_doomguard,if=!talent.grimoire_of_supremacy.enabled&spell_targets.infernal_awakening<=2&(target.time_to_die>180|target.health.pct<=20|target.time_to_die<30)
0.00 summon_infernal,if=!talent.grimoire_of_supremacy.enabled&spell_targets.infernal_awakening>2
0.00 summon_doomguard,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal=1&artifact.lord_of_flames.rank>0&buff.lord_of_flames.remains&!pet.doomguard.active
0.00 summon_doomguard,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal=1&equipped.132379&!cooldown.sindorei_spite_icd.remains
0.00 summon_infernal,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal>1&equipped.132379&!cooldown.sindorei_spite_icd.remains
O 2.90 soul_harvest
0.00 channel_demonfire,if=dot.immolate.remains>cast_time
0.00 havoc,if=active_enemies=1&talent.wreak_havoc.enabled&equipped.132375&!debuff.havoc.remains
0.00 rain_of_fire,if=active_enemies>=3&cooldown.havoc.remains<=12&!talent.wreak_havoc.enabled
0.00 rain_of_fire,if=active_enemies>=6&talent.wreak_havoc.enabled
P 12.13 dimensional_rift,if=!equipped.144369|charges>1|((!talent.grimoire_of_service.enabled|recharge_time<cooldown.service_pet.remains)&(!talent.soul_harvest.enabled|recharge_time<cooldown.soul_harvest.remains)&(!talent.grimoire_of_supremacy.enabled|recharge_time<cooldown.summon_doomguard.remains))
0.00 life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<duration*0.3
0.00 cataclysm
Q 58.70 chaos_bolt,if=(cooldown.havoc.remains>12&cooldown.havoc.remains|active_enemies<3|talent.wreak_havoc.enabled&active_enemies<6)
0.00 shadowburn
0.00 conflagrate,if=!talent.roaring_blaze.enabled&!buff.backdraft.remains
0.00 immolate,if=!talent.roaring_blaze.enabled&remains<=duration*0.3
R 79.94 incinerate
S 7.51 life_tap

Sample Sequence

0126ABCDEGHJKLMKOPPQKQRRKQRRRRKRCRQRERRRRRRGJKQKQQKRRCQQRKPRRQREQRRSCGJQKKQRKQRRRKQCQQERRRSRRPQRRGJKLQCQKKQRQKQRRRESQRCRQROIRRRSGJKKQPQKQRCKQRPRRRREQQRRRSRRGCJQKQKFQQKQKPQHRRCEQRRPRSGJKKLQRKCQRRKQRRRRRSERRRQQPCRGJQKNQKKQRRQKCORPQESRRRRRQGJKCQKPQJQQRJQRRREJFLQJCQSQJ

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask Alythess' 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 1 food Alythess' 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 2 summon_imp Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 6 augmentation Alythess' 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat A potion Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard potion_of_prolonged_power
0:00.000 precombat B chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard embrace_chaos, accelerando, potion_of_prolonged_power
0:00.000 default C havoc enemy2 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard embrace_chaos, accelerando, potion_of_prolonged_power
0:01.145 default D dimensional_rift Fluffy_Pillow 1033543.2/1100000: 94% mana | 1.0/5: 20% soul_shard bloodlust, embrace_chaos, accelerando, potion_of_prolonged_power
0:02.027 default E immolate Fluffy_Pillow 1050138.0/1100000: 95% mana | 1.0/5: 20% soul_shard bloodlust, embrace_chaos, accelerando, potion_of_prolonged_power
0:02.907 default G immolate Fluffy_Pillow 1000695.2/1100000: 91% mana | 1.0/5: 20% soul_shard bloodlust, embrace_chaos, accelerando, potion_of_prolonged_power
0:03.788 default H berserking Fluffy_Pillow 951271.2/1100000: 86% mana | 1.0/5: 20% soul_shard bloodlust, embrace_chaos, accelerando, potion_of_prolonged_power
0:03.788 default J conflagrate Fluffy_Pillow 951271.2/1100000: 86% mana | 1.0/5: 20% soul_shard bloodlust, berserking, embrace_chaos, accelerando, potion_of_prolonged_power
0:04.555 default K conflagrate Fluffy_Pillow 967866.9/1100000: 88% mana | 2.0/5: 40% soul_shard bloodlust, berserking, conflagration_of_chaos, accelerando, potion_of_prolonged_power
0:05.321 default L service_imp Fluffy_Pillow 984441.1/1100000: 89% mana | 4.0/5: 80% soul_shard bloodlust, berserking, nefarious_pact, accelerando, potion_of_prolonged_power
0:06.074 default M summon_infernal Fluffy_Pillow 1000733.9/1100000: 91% mana | 3.0/5: 60% soul_shard bloodlust, berserking, nefarious_pact, accelerando, potion_of_prolonged_power
0:06.830 default K conflagrate Fluffy_Pillow 1017091.6/1100000: 92% mana | 2.0/5: 40% soul_shard bloodlust, berserking, lord_of_flames, nefarious_pact, accelerando, potion_of_prolonged_power
0:07.584 default O soul_harvest Fluffy_Pillow 1033649.1/1100000: 94% mana | 3.0/5: 60% soul_shard bloodlust, berserking, lord_of_flames, nefarious_pact, accelerando(2), potion_of_prolonged_power
0:07.584 default P dimensional_rift Fluffy_Pillow 1033649.1/1100000: 94% mana | 3.0/5: 60% soul_shard bloodlust, berserking, soul_harvest, lord_of_flames, nefarious_pact, accelerando(2), potion_of_prolonged_power
0:08.338 default P dimensional_rift Fluffy_Pillow 1050449.3/1100000: 95% mana | 3.0/5: 60% soul_shard bloodlust, berserking, soul_harvest, lord_of_flames, nefarious_pact, accelerando(3), potion_of_prolonged_power
0:09.092 default Q chaos_bolt Fluffy_Pillow 1067327.6/1100000: 97% mana | 3.0/5: 60% soul_shard bloodlust, berserking, soul_harvest, lord_of_flames, nefarious_pact, accelerando(4), potion_of_prolonged_power
0:10.108 default K conflagrate Fluffy_Pillow 1090293.0/1100000: 99% mana | 1.0/5: 20% soul_shard bloodlust, berserking, soul_harvest, lord_of_flames, embrace_chaos, nefarious_pact, accelerando(4), potion_of_prolonged_power
0:10.862 default Q chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 2.0/5: 40% soul_shard bloodlust, berserking, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(4), potion_of_prolonged_power
0:11.616 default R incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard bloodlust, berserking, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(4), potion_of_prolonged_power
0:12.372 default R incinerate Fluffy_Pillow 1037197.3/1100000: 94% mana | 1.0/5: 20% soul_shard bloodlust, berserking, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, potion_of_prolonged_power
0:13.126 default K conflagrate Fluffy_Pillow 987269.1/1100000: 90% mana | 1.0/5: 20% soul_shard bloodlust, berserking, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, potion_of_prolonged_power
0:13.881 default Q chaos_bolt Fluffy_Pillow 1003251.6/1100000: 91% mana | 2.0/5: 40% soul_shard bloodlust, soul_harvest, lord_of_flames, embrace_chaos, nefarious_pact, accelerando, potion_of_prolonged_power
0:14.636 default R incinerate Fluffy_Pillow 1017500.4/1100000: 93% mana | 0.0/5: 0% soul_shard bloodlust, soul_harvest, lord_of_flames, embrace_chaos, nefarious_pact, accelerando(2), potion_of_prolonged_power
0:15.390 default R incinerate Fluffy_Pillow 965898.2/1100000: 88% mana | 0.0/5: 0% soul_shard bloodlust, soul_harvest, lord_of_flames, embrace_chaos, nefarious_pact, accelerando(2), potion_of_prolonged_power
0:16.146 default R incinerate Fluffy_Pillow 914334.2/1100000: 83% mana | 0.0/5: 0% soul_shard bloodlust, soul_harvest, lord_of_flames, embrace_chaos, nefarious_pact, accelerando(2), potion_of_prolonged_power
0:16.901 default R incinerate Fluffy_Pillow 862751.2/1100000: 78% mana | 0.0/5: 0% soul_shard bloodlust, soul_harvest, lord_of_flames, embrace_chaos, devils_due, accelerando(2), potion_of_prolonged_power
0:18.126 default K conflagrate Fluffy_Pillow 820142.9/1100000: 75% mana | 0.0/5: 0% soul_shard bloodlust, soul_harvest, lord_of_flames, embrace_chaos, devils_due, accelerando(2), potion_of_prolonged_power
0:19.148 default R incinerate Fluffy_Pillow 839719.5/1100000: 76% mana | 1.0/5: 20% soul_shard bloodlust, soul_harvest, lord_of_flames, devils_due, accelerando(3), potion_of_prolonged_power
0:20.356 default C havoc enemy2 797124.7/1100000: 72% mana | 1.0/5: 20% soul_shard bloodlust, soul_harvest, lord_of_flames, devils_due, accelerando(3), potion_of_prolonged_power
0:21.364 default R incinerate Fluffy_Pillow 728766.7/1100000: 66% mana | 1.0/5: 20% soul_shard bloodlust, soul_harvest, lord_of_flames, devils_due, accelerando(4), potion_of_prolonged_power
0:22.553 default Q chaos_bolt Fluffy_Pillow 686137.0/1100000: 62% mana | 2.0/5: 40% soul_shard bloodlust, soul_harvest, lord_of_flames, devils_due, accelerando(4), potion_of_prolonged_power
0:24.537 default R incinerate Fluffy_Pillow 725392.9/1100000: 66% mana | 1.0/5: 20% soul_shard bloodlust, soul_harvest, lord_of_flames, embrace_chaos, devils_due, accelerando(5), potion_of_prolonged_power
0:25.711 default E immolate Fluffy_Pillow 682374.1/1100000: 62% mana | 1.0/5: 20% soul_shard bloodlust, soul_harvest, lord_of_flames, embrace_chaos, potion_of_prolonged_power
0:26.604 default R incinerate Fluffy_Pillow 632926.0/1100000: 58% mana | 1.0/5: 20% soul_shard bloodlust, lord_of_flames, embrace_chaos, potion_of_prolonged_power
0:27.679 default R incinerate Fluffy_Pillow 586990.0/1100000: 53% mana | 1.0/5: 20% soul_shard bloodlust, lord_of_flames, embrace_chaos, accelerando, potion_of_prolonged_power
0:28.735 default R incinerate Fluffy_Pillow 540858.6/1100000: 49% mana | 1.0/5: 20% soul_shard bloodlust, lord_of_flames, accelerando, potion_of_prolonged_power
0:29.790 default R incinerate Fluffy_Pillow 494708.5/1100000: 45% mana | 1.0/5: 20% soul_shard bloodlust, lord_of_flames, accelerando, potion_of_prolonged_power
0:30.846 default R incinerate Fluffy_Pillow 448577.1/1100000: 41% mana | 1.0/5: 20% soul_shard bloodlust, lord_of_flames, nefarious_pact, accelerando, potion_of_prolonged_power
0:31.600 default R incinerate Fluffy_Pillow 396770.6/1100000: 36% mana | 1.0/5: 20% soul_shard bloodlust, lord_of_flames, nefarious_pact, accelerando(2), potion_of_prolonged_power
0:32.354 default G immolate Fluffy_Pillow 345168.4/1100000: 31% mana | 1.0/5: 20% soul_shard bloodlust, lord_of_flames, nefarious_pact, accelerando(2), potion_of_prolonged_power
0:33.110 default J conflagrate Fluffy_Pillow 293648.7/1100000: 27% mana | 1.0/5: 20% soul_shard bloodlust, lord_of_flames, nefarious_pact, accelerando(3), potion_of_prolonged_power
0:33.865 default K conflagrate Fluffy_Pillow 308276.9/1100000: 28% mana | 2.0/5: 40% soul_shard bloodlust, lord_of_flames, nefarious_pact, accelerando(3), potion_of_prolonged_power
0:34.619 default Q chaos_bolt Fluffy_Pillow 322885.8/1100000: 29% mana | 4.0/5: 80% soul_shard bloodlust, lord_of_flames, nefarious_pact, accelerando(3), potion_of_prolonged_power
0:35.805 default K conflagrate Fluffy_Pillow 345965.1/1100000: 31% mana | 2.0/5: 40% soul_shard bloodlust, lord_of_flames, embrace_chaos, nefarious_pact, accelerando(4), potion_of_prolonged_power
0:36.559 default Q chaos_bolt Fluffy_Pillow 360785.3/1100000: 33% mana | 3.0/5: 60% soul_shard bloodlust, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(4), potion_of_prolonged_power
0:37.313 default Q chaos_bolt Fluffy_Pillow 375605.5/1100000: 34% mana | 2.0/5: 40% soul_shard bloodlust, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(4), potion_of_prolonged_power
0:38.066 default K conflagrate Fluffy_Pillow 390406.0/1100000: 35% mana | 0.0/5: 0% soul_shard bloodlust, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(4), potion_of_prolonged_power
0:38.974 default R incinerate Fluffy_Pillow 408253.2/1100000: 37% mana | 1.0/5: 20% soul_shard bloodlust, lord_of_flames, embrace_chaos, nefarious_pact, accelerando(4), potion_of_prolonged_power
0:39.728 default R incinerate Fluffy_Pillow 356462.8/1100000: 32% mana | 1.0/5: 20% soul_shard bloodlust, lord_of_flames, embrace_chaos, nefarious_pact, potion_of_prolonged_power
0:40.482 default C havoc enemy2 304438.2/1100000: 28% mana | 3.0/5: 60% soul_shard bloodlust, lord_of_flames, embrace_chaos, nefarious_pact, potion_of_prolonged_power
0:41.236 default Q chaos_bolt Fluffy_Pillow 227188.6/1100000: 21% mana | 3.0/5: 60% soul_shard lord_of_flames, embrace_chaos, nefarious_pact, potion_of_prolonged_power
0:42.202 default Q chaos_bolt Fluffy_Pillow 240961.6/1100000: 22% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, devils_due, potion_of_prolonged_power
0:43.843 default R incinerate Fluffy_Pillow 264358.6/1100000: 24% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos, devils_due, potion_of_prolonged_power
0:45.485 default K conflagrate Fluffy_Pillow 221769.8/1100000: 20% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos, devils_due, potion_of_prolonged_power
0:46.852 default P dimensional_rift Fluffy_Pillow 241260.2/1100000: 22% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, devils_due, potion_of_prolonged_power
0:48.219 default R incinerate Fluffy_Pillow 261044.9/1100000: 24% mana | 1.0/5: 20% soul_shard lord_of_flames, devils_due, accelerando, potion_of_prolonged_power
0:49.836 default R incinerate Fluffy_Pillow 218447.8/1100000: 20% mana | 1.0/5: 20% soul_shard lord_of_flames, devils_due, accelerando, potion_of_prolonged_power
0:51.453 default Q chaos_bolt Fluffy_Pillow 175928.6/1100000: 16% mana | 2.0/5: 40% soul_shard lord_of_flames, accelerando(2), potion_of_prolonged_power
0:53.702 default R incinerate Fluffy_Pillow 208963.4/1100000: 19% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos, accelerando(2), potion_of_prolonged_power
0:55.054 default E immolate Fluffy_Pillow 162822.5/1100000: 15% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos, accelerando(2), potion_of_prolonged_power
0:56.183 default Q chaos_bolt Fluffy_Pillow 113529.8/1100000: 10% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando(3), potion_of_prolonged_power
0:57.515 default R incinerate Fluffy_Pillow 133382.7/1100000: 12% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando(4), potion_of_prolonged_power
0:58.828 default R incinerate Fluffy_Pillow 87234.7/1100000: 8% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando(4)
1:00.141 default S life_tap Fluffy_Pillow 39976.7/1100000: 4% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando
1:01.285 default C havoc enemy2 386649.7/1100000: 35% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando(2)
1:02.410 default G immolate Fluffy_Pillow 315174.4/1100000: 29% mana | 2.0/5: 40% soul_shard lord_of_flames, accelerando(2)
1:03.537 default J conflagrate Fluffy_Pillow 265728.6/1100000: 24% mana | 2.0/5: 40% soul_shard lord_of_flames, accelerando(2)
1:04.665 default Q chaos_bolt Fluffy_Pillow 282297.4/1100000: 26% mana | 3.0/5: 60% soul_shard lord_of_flames, accelerando(2)
1:06.915 default K conflagrate Fluffy_Pillow 315346.9/1100000: 29% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando(2)
1:08.042 default K conflagrate Fluffy_Pillow 331901.0/1100000: 30% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando(2)
1:09.171 default Q chaos_bolt Fluffy_Pillow 348484.5/1100000: 32% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
1:10.523 default R incinerate Fluffy_Pillow 368343.6/1100000: 33% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
1:11.876 default K conflagrate Fluffy_Pillow 322218.7/1100000: 29% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
1:12.986 default Q chaos_bolt Fluffy_Pillow 338213.4/1100000: 31% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
1:14.377 default R incinerate Fluffy_Pillow 358046.0/1100000: 33% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
1:15.768 default R incinerate Fluffy_Pillow 311879.2/1100000: 28% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
1:17.141 default R incinerate Fluffy_Pillow 265750.7/1100000: 24% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
1:18.513 default K conflagrate Fluffy_Pillow 219607.7/1100000: 20% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, accelerando
1:19.656 default Q chaos_bolt Fluffy_Pillow 236150.4/1100000: 21% mana | 2.0/5: 40% soul_shard lord_of_flames, accelerando
1:21.941 default C havoc enemy2 269410.1/1100000: 24% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando(2)
1:23.066 default Q chaos_bolt Fluffy_Pillow 197934.8/1100000: 18% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando(2)
1:24.416 default Q chaos_bolt Fluffy_Pillow 217994.9/1100000: 20% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, nefarious_pact, accelerando(3)
1:25.341 default E immolate Fluffy_Pillow 231781.1/1100000: 21% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, nefarious_pact, accelerando(3)
1:26.112 default R incinerate Fluffy_Pillow 177272.0/1100000: 16% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, nefarious_pact, accelerando(3)
1:27.036 default R incinerate Fluffy_Pillow 125043.3/1100000: 11% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, nefarious_pact, accelerando(3)
1:27.960 default R incinerate Fluffy_Pillow 72688.5/1100000: 7% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, nefarious_pact
1:28.928 default S life_tap Fluffy_Pillow 20490.1/1100000: 2% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, nefarious_pact
1:29.734 default R incinerate Fluffy_Pillow 361981.8/1100000: 33% mana | 1.0/5: 20% soul_shard lord_of_flames, nefarious_pact
1:30.702 default R incinerate Fluffy_Pillow 309783.3/1100000: 28% mana | 1.0/5: 20% soul_shard lord_of_flames, nefarious_pact
1:31.669 default P dimensional_rift Fluffy_Pillow 257681.5/1100000: 23% mana | 1.0/5: 20% soul_shard lord_of_flames, nefarious_pact, accelerando
1:32.461 default Q chaos_bolt Fluffy_Pillow 269144.1/1100000: 24% mana | 2.0/5: 40% soul_shard lord_of_flames, nefarious_pact, accelerando
1:34.045 default R incinerate Fluffy_Pillow 292347.2/1100000: 27% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, nefarious_pact, accelerando(2)
1:34.981 default R incinerate Fluffy_Pillow 240095.8/1100000: 22% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, nefarious_pact, accelerando(2)
1:35.918 default G immolate Fluffy_Pillow 187859.0/1100000: 17% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, devils_due, accelerando(2)
1:37.246 default J conflagrate Fluffy_Pillow 141365.6/1100000: 13% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, devils_due, accelerando(2)
1:38.574 default K conflagrate Fluffy_Pillow 160879.7/1100000: 15% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, devils_due, accelerando(3)
1:39.883 default L service_imp Fluffy_Pillow 180389.0/1100000: 16% mana | 4.0/5: 80% soul_shard lord_of_flames, devils_due, accelerando(3)
1:41.191 default Q chaos_bolt Fluffy_Pillow 199884.4/1100000: 18% mana | 4.0/5: 80% soul_shard lord_of_flames, devils_due, accelerando(4)
1:43.767 default C havoc enemy2 238305.3/1100000: 22% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando
1:44.908 default Q chaos_bolt Fluffy_Pillow 166819.0/1100000: 15% mana | 3.0/5: 60% soul_shard lord_of_flames, embrace_chaos, accelerando
1:46.282 default K conflagrate Fluffy_Pillow 186705.0/1100000: 17% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando
1:47.427 default K conflagrate Fluffy_Pillow 203276.7/1100000: 18% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando
1:48.573 default Q chaos_bolt Fluffy_Pillow 219862.8/1100000: 20% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
1:49.946 default R incinerate Fluffy_Pillow 239735.4/1100000: 22% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
1:51.297 default Q chaos_bolt Fluffy_Pillow 193722.3/1100000: 18% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
1:52.628 default K conflagrate Fluffy_Pillow 213559.5/1100000: 19% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
1:53.741 default Q chaos_bolt Fluffy_Pillow 230147.6/1100000: 21% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando(3)
1:55.073 default R incinerate Fluffy_Pillow 249999.7/1100000: 23% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos, accelerando(3)
1:56.405 default R incinerate Fluffy_Pillow 203436.3/1100000: 18% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos
1:57.797 default R incinerate Fluffy_Pillow 157283.1/1100000: 14% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos
1:59.191 default E immolate Fluffy_Pillow 111159.7/1100000: 10% mana | 1.0/5: 20% soul_shard lord_of_flames, accelerando
2:00.337 default S life_tap Fluffy_Pillow 61745.9/1100000: 6% mana | 1.0/5: 20% soul_shard lord_of_flames, accelerando
2:01.481 default Q chaos_bolt Fluffy_Pillow 408303.0/1100000: 37% mana | 3.0/5: 60% soul_shard lord_of_flames, accelerando
2:03.765 default R incinerate Fluffy_Pillow 441360.4/1100000: 40% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, nefarious_pact, accelerando(2)
2:04.703 default C havoc enemy2 389182.1/1100000: 35% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, nefarious_pact, accelerando(3)
2:05.475 default R incinerate Fluffy_Pillow 312687.9/1100000: 28% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, nefarious_pact, accelerando(3)
2:06.401 default Q chaos_bolt Fluffy_Pillow 260489.0/1100000: 24% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, nefarious_pact, accelerando(3)
2:07.325 default R incinerate Fluffy_Pillow 274260.3/1100000: 25% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos, nefarious_pact, accelerando(3)
2:08.248 default O soul_harvest Fluffy_Pillow 222016.7/1100000: 20% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos, nefarious_pact, accelerando(3)
2:08.248 default I potion Fluffy_Pillow 222016.7/1100000: 20% mana | 0.0/5: 0% soul_shard soul_harvest, lord_of_flames, embrace_chaos, nefarious_pact, accelerando(3)
2:08.248 default R incinerate Fluffy_Pillow 222016.7/1100000: 20% mana | 0.0/5: 0% soul_shard soul_harvest, lord_of_flames, embrace_chaos, nefarious_pact, accelerando(3), potion_of_deadly_grace
2:09.172 default R incinerate Fluffy_Pillow 169798.3/1100000: 15% mana | 0.0/5: 0% soul_shard soul_harvest, lord_of_flames, embrace_chaos, nefarious_pact, accelerando(4), potion_of_deadly_grace
2:10.084 default R incinerate Fluffy_Pillow 117587.3/1100000: 11% mana | 0.0/5: 0% soul_shard soul_harvest, lord_of_flames, embrace_chaos, nefarious_pact, accelerando(4), potion_of_deadly_grace
2:10.993 default S life_tap Fluffy_Pillow 65403.1/1100000: 6% mana | 0.0/5: 0% soul_shard soul_harvest, lord_of_flames, embrace_chaos, nefarious_pact, accelerando(5), potion_of_deadly_grace
2:11.746 default G immolate Fluffy_Pillow 406346.0/1100000: 37% mana | 0.0/5: 0% soul_shard soul_harvest, lord_of_flames, nefarious_pact, potion_of_deadly_grace
2:12.552 default J conflagrate Fluffy_Pillow 351837.8/1100000: 32% mana | 0.0/5: 0% soul_shard soul_harvest, lord_of_flames, nefarious_pact, potion_of_deadly_grace
2:13.358 default K conflagrate Fluffy_Pillow 363329.6/1100000: 33% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, nefarious_pact, potion_of_deadly_grace
2:14.163 default K conflagrate Fluffy_Pillow 374807.1/1100000: 34% mana | 2.0/5: 40% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, nefarious_pact, potion_of_deadly_grace
2:14.968 default Q chaos_bolt Fluffy_Pillow 386284.5/1100000: 35% mana | 3.0/5: 60% soul_shard soul_harvest, lord_of_flames, devils_due, potion_of_deadly_grace
2:17.701 default P dimensional_rift Fluffy_Pillow 425752.9/1100000: 39% mana | 2.0/5: 40% soul_shard soul_harvest, lord_of_flames, embrace_chaos, devils_due, accelerando(2), potion_of_deadly_grace
2:19.028 default Q chaos_bolt Fluffy_Pillow 445244.7/1100000: 40% mana | 2.0/5: 40% soul_shard soul_harvest, lord_of_flames, embrace_chaos, devils_due, accelerando(2), potion_of_deadly_grace
2:20.621 default K conflagrate Fluffy_Pillow 468643.8/1100000: 43% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, embrace_chaos, devils_due, accelerando(2), potion_of_deadly_grace
2:21.947 default Q chaos_bolt Fluffy_Pillow 488121.0/1100000: 44% mana | 3.0/5: 60% soul_shard soul_harvest, lord_of_flames, embrace_chaos, devils_due, accelerando(2), potion_of_deadly_grace
2:23.539 default R incinerate Fluffy_Pillow 511535.9/1100000: 47% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, embrace_chaos, accelerando(3), potion_of_deadly_grace
2:24.871 default C havoc enemy2 465388.9/1100000: 42% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, embrace_chaos, accelerando(4), potion_of_deadly_grace
2:25.965 default K conflagrate Fluffy_Pillow 393929.7/1100000: 36% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, embrace_chaos, accelerando(4), potion_of_deadly_grace
2:27.183 default Q chaos_bolt Fluffy_Pillow 412345.3/1100000: 37% mana | 2.0/5: 40% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(4), potion_of_deadly_grace
2:28.496 default R incinerate Fluffy_Pillow 431232.9/1100000: 39% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando, potion_of_deadly_grace
2:29.869 default P dimensional_rift Fluffy_Pillow 385104.5/1100000: 35% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando, potion_of_deadly_grace
2:31.012 default R incinerate Fluffy_Pillow 401697.2/1100000: 37% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(2), potion_of_deadly_grace
2:31.950 default R incinerate Fluffy_Pillow 349475.2/1100000: 32% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(2), potion_of_deadly_grace
2:32.885 default R incinerate Fluffy_Pillow 297322.3/1100000: 27% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, nefarious_pact, accelerando(3), potion_of_deadly_grace
2:33.811 default R incinerate Fluffy_Pillow 245123.4/1100000: 22% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, nefarious_pact, accelerando(3), potion_of_deadly_grace
2:34.737 default E immolate Fluffy_Pillow 192924.5/1100000: 18% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, nefarious_pact, accelerando(3), potion_of_deadly_grace
2:35.509 default Q chaos_bolt Fluffy_Pillow 138430.3/1100000: 13% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, nefarious_pact, accelerando(3), potion_of_deadly_grace
2:37.048 default Q chaos_bolt Fluffy_Pillow 161367.6/1100000: 15% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(3), potion_of_deadly_grace
2:37.971 default R incinerate Fluffy_Pillow 175123.9/1100000: 16% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(3), potion_of_deadly_grace
2:38.894 default R incinerate Fluffy_Pillow 122880.3/1100000: 11% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(3)
2:39.818 default R incinerate Fluffy_Pillow 70651.6/1100000: 6% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(3)
2:40.741 default S life_tap Fluffy_Pillow 18247.0/1100000: 2% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact
2:41.545 default R incinerate Fluffy_Pillow 359710.3/1100000: 33% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact
2:42.512 default R incinerate Fluffy_Pillow 307575.0/1100000: 28% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, devils_due, accelerando
2:44.129 default G immolate Fluffy_Pillow 264978.0/1100000: 24% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, devils_due, accelerando
2:45.477 default C havoc enemy2 218625.4/1100000: 20% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, devils_due, accelerando(2)
2:46.802 default J conflagrate Fluffy_Pillow 150087.9/1100000: 14% mana | 1.0/5: 20% soul_shard lord_of_flames, devils_due, accelerando(2)
2:48.129 default Q chaos_bolt Fluffy_Pillow 169865.5/1100000: 15% mana | 3.0/5: 60% soul_shard lord_of_flames, devils_due, accelerando(3)
2:50.743 default K conflagrate Fluffy_Pillow 208824.5/1100000: 19% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando(3)
2:51.855 default Q chaos_bolt Fluffy_Pillow 225397.7/1100000: 20% mana | 3.0/5: 60% soul_shard lord_of_flames, embrace_chaos, accelerando(3)
2:53.188 default K conflagrate Fluffy_Pillow 245264.7/1100000: 22% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando(3)
2:54.299 default F immolate enemy2 261728.0/1100000: 24% mana | 4.0/5: 80% soul_shard lord_of_flames, embrace_chaos
2:55.461 default Q chaos_bolt Fluffy_Pillow 212404.3/1100000: 19% mana | 5.0/5: 100% soul_shard lord_of_flames, embrace_chaos, accelerando
2:56.833 default Q chaos_bolt Fluffy_Pillow 232262.2/1100000: 21% mana | 3.0/5: 60% soul_shard lord_of_flames, embrace_chaos, accelerando(2)
2:58.184 default K conflagrate Fluffy_Pillow 252106.6/1100000: 23% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando(2)
2:59.312 default Q chaos_bolt Fluffy_Pillow 268675.4/1100000: 24% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
3:00.663 default K conflagrate Fluffy_Pillow 288519.8/1100000: 26% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
3:01.789 default P dimensional_rift Fluffy_Pillow 305065.0/1100000: 28% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
3:02.899 default Q chaos_bolt Fluffy_Pillow 321608.4/1100000: 29% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
3:04.229 default H berserking Fluffy_Pillow 341430.7/1100000: 31% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
3:04.229 default R incinerate Fluffy_Pillow 341430.7/1100000: 31% mana | 0.0/5: 0% soul_shard berserking, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
3:05.389 default R incinerate Fluffy_Pillow 295312.6/1100000: 27% mana | 0.0/5: 0% soul_shard berserking, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
3:06.549 default C havoc enemy2 249194.5/1100000: 23% mana | 2.0/5: 40% soul_shard berserking, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
3:07.516 default E immolate Fluffy_Pillow 177352.3/1100000: 16% mana | 2.0/5: 40% soul_shard berserking, lord_of_flames, conflagration_of_chaos, embrace_chaos
3:08.525 default Q chaos_bolt Fluffy_Pillow 127989.9/1100000: 12% mana | 2.0/5: 40% soul_shard berserking, lord_of_flames, conflagration_of_chaos, accelerando
3:10.512 default R incinerate Fluffy_Pillow 161061.6/1100000: 15% mana | 0.0/5: 0% soul_shard berserking, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
3:11.708 default R incinerate Fluffy_Pillow 115179.6/1100000: 10% mana | 0.0/5: 0% soul_shard berserking, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
3:12.886 default P dimensional_rift Fluffy_Pillow 69078.3/1100000: 6% mana | 0.0/5: 0% soul_shard berserking, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
3:13.867 default R incinerate Fluffy_Pillow 85649.3/1100000: 8% mana | 0.0/5: 0% soul_shard berserking, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
3:15.043 default S life_tap Fluffy_Pillow 37720.8/1100000: 3% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, accelerando(2)
3:16.172 default G immolate Fluffy_Pillow 384304.3/1100000: 35% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, accelerando(2)
3:17.298 default J conflagrate Fluffy_Pillow 334900.4/1100000: 30% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, accelerando(3)
3:18.412 default K conflagrate Fluffy_Pillow 351503.4/1100000: 32% mana | 1.0/5: 20% soul_shard lord_of_flames, accelerando(3)
3:19.523 default K conflagrate Fluffy_Pillow 368061.7/1100000: 33% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, accelerando(3)
3:20.633 default L service_imp Fluffy_Pillow 384291.1/1100000: 35% mana | 3.0/5: 60% soul_shard lord_of_flames
3:21.797 default Q chaos_bolt Fluffy_Pillow 400952.1/1100000: 36% mana | 2.0/5: 40% soul_shard lord_of_flames, accelerando
3:24.082 default R incinerate Fluffy_Pillow 434270.2/1100000: 39% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando(2)
3:25.433 default K conflagrate Fluffy_Pillow 388114.5/1100000: 35% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando(2)
3:26.561 default C havoc enemy2 404683.4/1100000: 37% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
3:27.689 default Q chaos_bolt Fluffy_Pillow 333252.2/1100000: 30% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
3:29.041 default R incinerate Fluffy_Pillow 353112.3/1100000: 32% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
3:30.374 default R incinerate Fluffy_Pillow 306979.3/1100000: 28% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
3:31.708 default K conflagrate Fluffy_Pillow 260861.2/1100000: 24% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
3:32.820 default Q chaos_bolt Fluffy_Pillow 277434.4/1100000: 25% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(3)
3:33.744 default R incinerate Fluffy_Pillow 291044.8/1100000: 26% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact
3:34.710 default R incinerate Fluffy_Pillow 238817.8/1100000: 22% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact
3:35.675 default R incinerate Fluffy_Pillow 186576.5/1100000: 17% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact
3:36.642 default R incinerate Fluffy_Pillow 134524.0/1100000: 12% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando
3:37.593 default R incinerate Fluffy_Pillow 82287.9/1100000: 7% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando
3:38.543 default S life_tap Fluffy_Pillow 30037.3/1100000: 3% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, nefarious_pact, accelerando
3:39.336 default E immolate Fluffy_Pillow 371514.4/1100000: 34% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, nefarious_pact, accelerando
3:40.129 default R incinerate Fluffy_Pillow 316992.4/1100000: 29% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, nefarious_pact, accelerando(2)
3:41.065 default R incinerate Fluffy_Pillow 264828.4/1100000: 24% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, nefarious_pact, accelerando(3)
3:41.990 default R incinerate Fluffy_Pillow 212614.6/1100000: 19% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, nefarious_pact, accelerando(3)
3:42.913 default Q chaos_bolt Fluffy_Pillow 160371.0/1100000: 15% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, nefarious_pact, accelerando(3)
3:44.452 default Q chaos_bolt Fluffy_Pillow 183308.2/1100000: 17% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due, accelerando(3)
3:46.020 default P dimensional_rift Fluffy_Pillow 206677.6/1100000: 19% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due, accelerando(3)
3:47.454 default C havoc enemy2 228049.9/1100000: 21% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due, accelerando(3)
3:48.761 default R incinerate Fluffy_Pillow 158971.7/1100000: 14% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due
3:50.399 default G immolate Fluffy_Pillow 116338.2/1100000: 11% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, devils_due, accelerando
3:51.746 default J conflagrate Fluffy_Pillow 69833.4/1100000: 6% mana | 2.0/5: 40% soul_shard lord_of_flames, devils_due, accelerando
3:53.092 default Q chaos_bolt Fluffy_Pillow 89314.2/1100000: 8% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, accelerando
3:55.376 default K conflagrate Fluffy_Pillow 122370.7/1100000: 11% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
3:56.521 default N summon_doomguard Fluffy_Pillow 138942.3/1100000: 13% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
3:57.666 default Q chaos_bolt Fluffy_Pillow 155514.0/1100000: 14% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
3:59.039 default K conflagrate Fluffy_Pillow 175665.1/1100000: 16% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
4:00.151 default K conflagrate Fluffy_Pillow 192265.1/1100000: 17% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(4)
4:01.246 default Q chaos_bolt Fluffy_Pillow 208821.0/1100000: 19% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(4)
4:02.560 default R incinerate Fluffy_Pillow 228500.3/1100000: 21% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
4:03.954 default R incinerate Fluffy_Pillow 182375.6/1100000: 17% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
4:05.346 default Q chaos_bolt Fluffy_Pillow 136222.4/1100000: 12% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
4:06.737 default K conflagrate Fluffy_Pillow 156080.3/1100000: 14% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
4:07.881 default C havoc enemy2 172637.5/1100000: 16% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando
4:09.026 default O soul_harvest Fluffy_Pillow 101209.2/1100000: 9% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando
4:09.026 default R incinerate Fluffy_Pillow 101209.2/1100000: 9% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, embrace_chaos, accelerando
4:10.397 default P dimensional_rift Fluffy_Pillow 55051.8/1100000: 5% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, embrace_chaos, accelerando
4:11.542 default Q chaos_bolt Fluffy_Pillow 71623.4/1100000: 7% mana | 2.0/5: 40% soul_shard soul_harvest, lord_of_flames, accelerando
4:13.829 default E immolate Fluffy_Pillow 104723.3/1100000: 10% mana | 0.0/5: 0% soul_shard soul_harvest, lord_of_flames, embrace_chaos, accelerando
4:14.975 default S life_tap Fluffy_Pillow 55309.5/1100000: 5% mana | 0.0/5: 0% soul_shard soul_harvest, lord_of_flames, embrace_chaos, accelerando
4:16.121 default R incinerate Fluffy_Pillow 401895.6/1100000: 37% mana | 0.0/5: 0% soul_shard soul_harvest, lord_of_flames, embrace_chaos, accelerando
4:17.494 default R incinerate Fluffy_Pillow 355782.6/1100000: 32% mana | 0.0/5: 0% soul_shard soul_harvest, lord_of_flames, embrace_chaos, accelerando(2)
4:18.845 default R incinerate Fluffy_Pillow 309529.6/1100000: 28% mana | 0.0/5: 0% soul_shard soul_harvest, lord_of_flames
4:20.238 default R incinerate Fluffy_Pillow 263390.7/1100000: 24% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames
4:21.630 default R incinerate Fluffy_Pillow 217237.5/1100000: 20% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames
4:23.024 default Q chaos_bolt Fluffy_Pillow 171112.8/1100000: 16% mana | 2.0/5: 40% soul_shard soul_harvest, lord_of_flames
4:25.341 default G immolate Fluffy_Pillow 204148.1/1100000: 19% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, embrace_chaos
4:26.504 default J conflagrate Fluffy_Pillow 154729.8/1100000: 14% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, embrace_chaos
4:27.666 default K conflagrate Fluffy_Pillow 171297.3/1100000: 16% mana | 2.0/5: 40% soul_shard soul_harvest, lord_of_flames, embrace_chaos
4:28.828 default C havoc enemy2 187864.9/1100000: 17% mana | 3.0/5: 60% soul_shard lord_of_flames, embrace_chaos
4:29.990 default Q chaos_bolt Fluffy_Pillow 116682.6/1100000: 11% mana | 4.0/5: 80% soul_shard lord_of_flames, accelerando
4:32.275 default K conflagrate Fluffy_Pillow 149753.5/1100000: 14% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando
4:33.420 default P dimensional_rift Fluffy_Pillow 166325.2/1100000: 15% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
4:34.566 default Q chaos_bolt Fluffy_Pillow 183158.4/1100000: 17% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
4:35.918 default J conflagrate Fluffy_Pillow 203017.5/1100000: 18% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
4:37.045 default Q chaos_bolt Fluffy_Pillow 219571.6/1100000: 20% mana | 4.0/5: 80% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
4:38.398 default Q chaos_bolt Fluffy_Pillow 239536.2/1100000: 22% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
4:39.730 default R incinerate Fluffy_Pillow 259388.3/1100000: 24% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
4:41.062 default J conflagrate Fluffy_Pillow 213089.2/1100000: 19% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
4:42.221 default Q chaos_bolt Fluffy_Pillow 229613.9/1100000: 21% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos
4:43.614 default R incinerate Fluffy_Pillow 249475.0/1100000: 23% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos
4:45.005 default R incinerate Fluffy_Pillow 203307.5/1100000: 18% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos
4:46.398 default R incinerate Fluffy_Pillow 157168.6/1100000: 14% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos
4:47.790 default E immolate Fluffy_Pillow 111171.7/1100000: 10% mana | 3.0/5: 60% soul_shard lord_of_flames, accelerando
4:48.934 default J conflagrate Fluffy_Pillow 61728.9/1100000: 6% mana | 3.0/5: 60% soul_shard lord_of_flames, accelerando
4:50.079 default F immolate enemy2 78300.6/1100000: 7% mana | 4.0/5: 80% soul_shard lord_of_flames, conflagration_of_chaos, accelerando
4:51.224 default L service_imp Fluffy_Pillow 28872.2/1100000: 3% mana | 4.0/5: 80% soul_shard lord_of_flames, conflagration_of_chaos, accelerando
4:52.368 default Q chaos_bolt Fluffy_Pillow 45429.4/1100000: 4% mana | 4.0/5: 80% soul_shard lord_of_flames, conflagration_of_chaos, accelerando
4:54.651 default J conflagrate Fluffy_Pillow 78719.8/1100000: 7% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
4:55.778 default C havoc enemy2 95273.9/1100000: 9% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
4:56.906 default Q chaos_bolt Fluffy_Pillow 24085.6/1100000: 2% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
4:58.237 default S life_tap Fluffy_Pillow 43923.4/1100000: 4% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(4)
4:59.331 default Q chaos_bolt Fluffy_Pillow 390234.2/1100000: 35% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
5:00.723 default J conflagrate Fluffy_Pillow 410081.0/1100000: 37% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4201 3876 0
Agility 7254 6929 0
Stamina 52473 52473 34105
Intellect 49775 48068 38456 (1278)
Spirit 1 1 0
Health 3148380 3148380 0
Mana 1100000 1100000 0
Soul Shard 5 5 0
Spell Power 49775 48068 0
Crit 19.29% 19.29% 5714
Haste 29.62% 28.62% 10731
Damage / Heal Versatility 3.41% 3.41% 1620
ManaReg per Second 14258 14148 0
Mastery 66.15% 66.15% 5618
Armor 1954 1954 1954
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 906.00
Local Head Eyes of Azj'Aqir
ilevel: 900, stats: { 253 Armor, +3255 Sta, +2170 Int, +1074 Haste, +578 Vers }
Local Neck Radiant String of Scorpid Eyes
ilevel: 900, stats: { +1831 Sta, +2011 Haste, +922 Crit }, enchant: mark_of_the_hidden_satyr
Local Shoulders Pauldrons of Azj'Aqir
ilevel: 900, stats: { 233 Armor, +2442 Sta, +1628 Int, +752 Mastery, +487 Vers }
Local Chest Robes of Fluctuating Energy
ilevel: 900, stats: { 311 Armor, +3255 Sta, +2170 Int, +1145 Haste, +507 Mastery }
Local Waist Man'ari Skullbuckled Cinch
ilevel: 900, stats: { 175 Armor, +2442 Sta, +1628 Int, +699 Haste, +540 Mastery }
Local Legs Leggings of Azj'Aqir
ilevel: 900, stats: { 272 Armor, +3255 Sta, +2170 Int, +932 Crit, +720 Haste }
Local Feet Outcast Wanderer's Footrags
ilevel: 910, stats: { 222 Armor, +2680 Sta, +1786 Int, +864 Crit, +422 Mastery }
Local Wrists Woven Lasher Tendril Bracers
ilevel: 900, stats: { 136 Armor, +1831 Sta, +1221 Int, +644 Haste, +285 Vers }
Local Hands Clutch of Azj'Aqir
ilevel: 900, stats: { 194 Armor, +2442 Sta, +1628 Int, +859 Crit, +380 Mastery }
Local Finger1 Ring of the Scoured Clan
ilevel: 900, stats: { +1831 Sta, +2095 Mastery, +838 Haste }, enchant: { +200 Haste }
Local Finger2 Alythess's Pyrogenics
ilevel: 940, stats: { +2658 Sta, +2137 Crit, +1602 Haste }, enchant: { +200 Haste }
Local Trinket1 Whispers in the Dark
ilevel: 905, stats: { +2162 Int }
Local Trinket2 Erratic Metronome
ilevel: 900, stats: { +2063 Int }
Local Back Astromancer's Greatcloak
ilevel: 905, stats: { 158 Armor, +1918 Sta, +1278 StrAgiInt, +676 Haste, +270 Vers }, enchant: { +200 Int }
Local Main Hand Scepter of Sargeras
ilevel: 929, weapon: { 7005 - 10509, 3.6 }, stats: { +2843 Int, +4265 Sta, +922 Haste, +922 Mastery, +15509 Int }, relics: { +61 ilevels, +59 ilevels, +61 ilevels }

Talents

Level
15 Backdraft (Destruction Warlock) Roaring Blaze (Destruction Warlock) Shadowburn (Destruction Warlock)
30 Reverse Entropy (Destruction Warlock) Eradication (Destruction Warlock) Empowered Life Tap
45 Demonic Circle Mortal Coil Shadowfury
60 Cataclysm (Destruction Warlock) Fire and Brimstone (Destruction Warlock) Soul Harvest
75 Demon Skin Burning Rush Dark Pact
90 Grimoire of Supremacy Grimoire of Service Grimoire of Sacrifice
100 Wreak Havoc (Destruction Warlock) Channel Demonfire (Destruction Warlock) Soul Conduit

Profile

warlock="Alythess'"
level=110
race=troll
role=spell
position=back
talents=2203021
artifact=38:142513:142516:142513:0:803:1:804:3:805:3:806:5:807:3:808:3:809:4:810:3:811:3:812:3:813:1:814:1:815:1:816:1:817:1:818:1:1355:1
spec=destruction

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,type=whispered_pact
actions.precombat+=/food,type=azshari_salad
actions.precombat+=/summon_pet,if=!talent.grimoire_of_supremacy.enabled&(!talent.grimoire_of_sacrifice.enabled|buff.demonic_power.down)
actions.precombat+=/summon_infernal,if=talent.grimoire_of_supremacy.enabled&artifact.lord_of_flames.rank>0
actions.precombat+=/summon_infernal,if=talent.grimoire_of_supremacy.enabled&active_enemies>1
actions.precombat+=/summon_doomguard,if=talent.grimoire_of_supremacy.enabled&active_enemies=1&artifact.lord_of_flames.rank=0
actions.precombat+=/augmentation,type=defiled
actions.precombat+=/snapshot_stats
actions.precombat+=/grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
actions.precombat+=/life_tap,if=talent.empowered_life_tap.enabled&!buff.empowered_life_tap.remains
actions.precombat+=/potion,name=prolonged_power
actions.precombat+=/chaos_bolt

# Executed every time the actor is available.
actions=havoc,target=2,if=active_enemies>1&(active_enemies<4|talent.wreak_havoc.enabled&active_enemies<6)&!debuff.havoc.remains
actions+=/dimensional_rift,if=charges=3
actions+=/immolate,if=remains<=tick_time
actions+=/immolate,cycle_targets=1,if=active_enemies>1&remains<=tick_time&(!talent.roaring_blaze.enabled|(!debuff.roaring_blaze.remains&action.conflagrate.charges<2))
actions+=/immolate,if=talent.roaring_blaze.enabled&remains<=duration&!debuff.roaring_blaze.remains&target.time_to_die>10&(action.conflagrate.charges=2+set_bonus.tier19_4pc|(action.conflagrate.charges>=1+set_bonus.tier19_4pc&action.conflagrate.recharge_time<cast_time+gcd)|target.time_to_die<24)
actions+=/berserking
actions+=/blood_fury
actions+=/arcane_torrent
actions+=/potion,name=deadly_grace,if=(buff.soul_harvest.remains|trinket.proc.any.react|target.time_to_die<=45)
actions+=/shadowburn,if=buff.conflagration_of_chaos.remains<=action.chaos_bolt.cast_time
actions+=/shadowburn,if=(charges=1&recharge_time<action.chaos_bolt.cast_time|charges=2)&soul_shard<5
actions+=/conflagrate,if=talent.roaring_blaze.enabled&(charges=2+set_bonus.tier19_4pc|(charges>=1+set_bonus.tier19_4pc&recharge_time<gcd)|target.time_to_die<24)
actions+=/conflagrate,if=talent.roaring_blaze.enabled&debuff.roaring_blaze.stack>0&dot.immolate.remains>dot.immolate.duration*0.3&(active_enemies=1|soul_shard<3)&soul_shard<5
actions+=/conflagrate,if=!talent.roaring_blaze.enabled&!buff.backdraft.remains&buff.conflagration_of_chaos.remains<=action.chaos_bolt.cast_time
actions+=/conflagrate,if=!talent.roaring_blaze.enabled&!buff.backdraft.remains&(charges=1&recharge_time<action.chaos_bolt.cast_time|charges=2)&soul_shard<5
actions+=/life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<=gcd
actions+=/dimensional_rift,if=equipped.144369&!buff.lessons_of_spacetime.remains&((!talent.grimoire_of_supremacy.enabled&!cooldown.summon_doomguard.remains)|(talent.grimoire_of_service.enabled&!cooldown.service_pet.remains)|(talent.soul_harvest.enabled&!cooldown.soul_harvest.remains))
actions+=/service_pet
actions+=/summon_infernal,if=artifact.lord_of_flames.rank>0&!buff.lord_of_flames.remains
actions+=/summon_doomguard,if=!talent.grimoire_of_supremacy.enabled&spell_targets.infernal_awakening<=2&(target.time_to_die>180|target.health.pct<=20|target.time_to_die<30)
actions+=/summon_infernal,if=!talent.grimoire_of_supremacy.enabled&spell_targets.infernal_awakening>2
actions+=/summon_doomguard,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal=1&artifact.lord_of_flames.rank>0&buff.lord_of_flames.remains&!pet.doomguard.active
actions+=/summon_doomguard,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal=1&equipped.132379&!cooldown.sindorei_spite_icd.remains
actions+=/summon_infernal,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal>1&equipped.132379&!cooldown.sindorei_spite_icd.remains
actions+=/soul_harvest
actions+=/channel_demonfire,if=dot.immolate.remains>cast_time
actions+=/havoc,if=active_enemies=1&talent.wreak_havoc.enabled&equipped.132375&!debuff.havoc.remains
actions+=/rain_of_fire,if=active_enemies>=3&cooldown.havoc.remains<=12&!talent.wreak_havoc.enabled
actions+=/rain_of_fire,if=active_enemies>=6&talent.wreak_havoc.enabled
actions+=/dimensional_rift,if=!equipped.144369|charges>1|((!talent.grimoire_of_service.enabled|recharge_time<cooldown.service_pet.remains)&(!talent.soul_harvest.enabled|recharge_time<cooldown.soul_harvest.remains)&(!talent.grimoire_of_supremacy.enabled|recharge_time<cooldown.summon_doomguard.remains))
actions+=/life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<duration*0.3
actions+=/cataclysm
actions+=/chaos_bolt,if=(cooldown.havoc.remains>12&cooldown.havoc.remains|active_enemies<3|talent.wreak_havoc.enabled&active_enemies<6)
actions+=/shadowburn
actions+=/conflagrate,if=!talent.roaring_blaze.enabled&!buff.backdraft.remains
actions+=/immolate,if=!talent.roaring_blaze.enabled&remains<=duration*0.3
actions+=/incinerate
actions+=/life_tap

head=eyes_of_azjaqir,id=138314,bonus_id=3445
neck=radiant_string_of_scorpid_eyes,id=140898,bonus_id=3445,enchant_id=5439
shoulders=pauldrons_of_azjaqir,id=138323,bonus_id=3445
back=astromancers_greatcloak,id=140909,bonus_id=3518,enchant_id=5436
chest=robes_of_fluctuating_energy,id=140848,bonus_id=3445
wrists=woven_lasher_tendril_bracers,id=140886,bonus_id=3445
hands=clutch_of_azjaqir,id=138311,bonus_id=3445
waist=manari_skullbuckled_cinch,id=140887,bonus_id=3445
legs=leggings_of_azjaqir,id=138317,bonus_id=3445
feet=outcast_wanderers_footrags,id=140914,bonus_id=3519
finger1=ring_of_the_scoured_clan,id=140897,bonus_id=3445,enchant=binding_of_haste
finger2=alythesss_pyrogenics,id=132460,ilevel=940,enchant=binding_of_haste
trinket1=whispers_in_the_dark,id=140809,ilevel=905
trinket2=erratic_metronome,id=140792,ilevel=900
main_hand=scepter_of_sargeras,id=128941,ilevel=929,gem_id=140826/140837/140826,relic_id=3519/3518:3518/3519

# Gear Summary
# gear_ilvl=905.93
# gear_stamina=34105
# gear_intellect=38456
# gear_crit_rating=5714
# gear_haste_rating=10731
# gear_mastery_rating=5618
# gear_versatility_rating=1620
# gear_armor=1954
# set_bonus=tier19_2pc=1
# set_bonus=tier19_4pc=1
default_pet=imp

Cloak : 983612 dps, 576851 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
983612.4 983612.4 0.0 / 0.000% 0.0 / 0.0% 30.6
RPS Out RPS In Primary Resource Waiting APM Active Skill
26279.1 26279.1 Mana 0.00% 50.6 100.0% 100%
Talents
  • 15: Roaring Blaze (Destruction Warlock)
  • 30: Eradication (Destruction Warlock)
  • 60: Soul Harvest
  • 90: Grimoire of Service
  • 100: Wreak Havoc (Destruction Warlock)
  • Talent Calculator
Artifact

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Cloak 983612
Chaos Bolt 317683 32.3% 57.5 5.07sec 1661046 1092635 Direct 109.7 0 870450 870450 100.0%  

Stats details: chaos_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 57.51 109.75 0.00 0.00 1.5202 0.0000 95531296.88 95531296.88 0.00 1092635.38 1092635.38
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 109.75 100.00% 870449.78 570318 1339991 870717.98 815807 927519 95531297 95531297 0.00
 
 

Action details: chaos_bolt

Static Values
  • id:116858
  • school:chromatic
  • resource:soul_shard
  • range:40.0
  • travel_speed:16.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:2.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:116858
  • name:Chaos Bolt
  • school:chromatic
  • tooltip:
  • description:Unleashes a devastating blast of chaos, causing {$s1=1} Chaos damage. Chaos Bolt always critically strikes and your critical strike chance increases its damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:4.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Conflagrate 106727 10.9% 48.3 6.21sec 663507 637608 Direct 96.1 195821 445088 333592 55.3%  

Stats details: conflagrate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 48.32 96.11 0.00 0.00 1.0406 0.0000 32060191.72 32060191.72 0.00 637607.73 637607.73
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 42.99 44.73% 195820.54 129878 305134 195931.18 175941 218915 8418019 8418019 0.00
crit 53.12 55.27% 445087.58 259760 705988 445209.38 402046 495419 23642173 23642173 0.00
 
 

Action details: conflagrate

Static Values
  • id:17962
  • school:fire
  • resource:chi
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:9.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.roaring_blaze.enabled&(charges=2+set_bonus.tier19_4pc|(charges>=1+set_bonus.tier19_4pc&recharge_time<gcd)|target.time_to_die<24)
Spelldata
  • id:17962
  • name:Conflagrate
  • school:fire
  • tooltip:
  • description:Triggers an explosion on the target, dealing {$s1=1} Fire damage.{$?s196406=false}[ Reduces the cast time of Incinerate and Chaos Bolt by {$117828s1=30}% for {$117828d=10 seconds}.][] |cFFFFFFFFGenerates 1 Soul Shard.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.265510
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Deadly Grace 5230 0.5% 14.2 2.10sec 108721 0 Direct 14.2 94058 187963 108724 15.6%  

Stats details: deadly_grace

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.20 14.20 0.00 0.00 0.0000 0.0000 1544336.13 1544336.13 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 11.99 84.39% 94057.98 83438 100126 94068.47 87147 100126 1127433 1127433 0.00
crit 2.22 15.61% 187962.81 166877 200252 170143.19 0 200252 416903 416903 0.00
 
 

Action details: deadly_grace

Static Values
  • id:188091
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:25.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188091
  • name:Deadly Grace
  • school:arcane
  • tooltip:
  • description:Deal {$s1=63339 to 95008} Arcane damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:63338.72
  • base_dd_max:95008.08
 
Immolate 235486 24.0% 19.9 15.28sec 3550038 3368790 Direct 38.6 135184 270445 199720 47.7%  
Periodic 293.0 145631 291381 215130 47.7% 195.9%

Stats details: immolate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 19.93 38.58 293.04 293.04 1.0538 2.0133 70747962.26 70747962.26 0.00 115795.75 3368790.17
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 20.17 52.29% 135184.41 90106 216829 135168.43 113442 153776 2727094 2727094 0.00
crit 18.41 47.71% 270445.17 180222 433003 270446.48 228957 309596 4978388 4978388 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 153.3 52.32% 145630.72 81 420633 145860.60 124640 167985 22326653 22326653 0.00
crit 139.7 47.68% 291380.89 89 841263 291822.88 249459 337730 40715827 40715827 0.00
 
 

Action details: immolate

Static Values
  • id:348
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:66000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.32
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:remains<=tick_time
Spelldata
  • id:348
  • name:Immolate
  • school:fire
  • tooltip:
  • description:Burns the enemy, causing {$s1=1} Fire damage immediately and an additional $157736o1 Fire damage over {$157736d=18 seconds}. |cFFFFFFFFPeriodic damage has a {$193541s1=15}% chance to generate 1 Soul Shard. Chance doubled on critical strikes.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.332000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.721500
  • base_td:0.00
  • dot_duration:18.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Incinerate 132380 13.5% 80.1 3.59sec 497748 403399 Direct 153.3 224621 449444 259914 15.7%  

Stats details: incinerate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 80.07 153.33 0.00 0.00 1.2339 0.0000 39852622.97 39852622.97 0.00 403399.29 403399.29
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 129.26 84.30% 224621.14 145657 342237 224685.84 210809 237606 29034613 29034613 0.00
crit 24.07 15.70% 449443.52 291315 684464 449592.54 388080 523544 10818010 10818010 0.00
 
 

Action details: incinerate

Static Values
  • id:29722
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:66000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:29722
  • name:Incinerate
  • school:fire
  • tooltip:
  • description:Draws fire toward the enemy, dealing {$s2=0} Fire damage.{$?s29722=true}|!c3[][ Replaces Shadow Bolt.]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.331000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Mark of the Hidden Satyr 8867 0.9% 19.9 15.02sec 133739 0 Direct 19.9 115705 231549 133738 15.6%  

Stats details: mark_of_the_hidden_satyr

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 19.93 19.93 0.00 0.00 0.0000 0.0000 2665262.17 2665262.17 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 16.83 84.43% 115704.60 110245 139199 115736.20 110245 125934 1946920 1946920 0.00
crit 3.10 15.57% 231549.45 220490 278398 221496.63 0 278398 718343 718343 0.00
 
 

Action details: mark_of_the_hidden_satyr

Static Values
  • id:191259
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191259
  • name:Mark of the Hidden Satyr
  • school:fire
  • tooltip:
  • description:Deals fire damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:2.500000
  • spell_power_mod.direct:2.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
pet - imp 42216 / 42216
Firebolt 42216 4.3% 108.6 2.77sec 116852 95811 Direct 107.8 101803 203621 117749 15.7%  

Stats details: firebolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 108.61 107.78 0.00 0.00 1.2196 0.0000 12690994.16 12690994.16 0.00 95811.46 95811.46
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 90.90 84.34% 101803.19 65046 123194 101830.43 99484 104196 9253994 9253994 0.00
crit 16.88 15.66% 203620.83 130092 246387 203681.81 177523 241149 3437000 3437000 0.00
 
 

Action details: firebolt

Static Values
  • id:3110
  • school:fire
  • resource:energy
  • range:40.0
  • travel_speed:16.0000
  • trigger_gcd:0.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.75
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:3110
  • name:Firebolt
  • school:fire
  • tooltip:
  • description:Deals {$s1=1} Fire damage to a target.$?a231795[ Damage increased by {$231795s1=50}% if you have Immolated the target.][] |cFF777777(Right-Click to toggle)|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
pet - service_imp 122577 / 39105
Firebolt 122577 4.0% 49.1 5.55sec 238905 208553 Direct 48.8 207644 415491 240284 15.7%  

Stats details: firebolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 49.05 48.77 0.00 0.00 1.1455 0.0000 11719427.04 11719427.04 0.00 208553.00 208553.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 41.11 84.29% 207643.77 130092 246387 207848.71 198857 216665 8536739 8536739 0.00
crit 7.66 15.71% 415490.89 260184 492774 415917.28 0 492774 3182688 3182688 0.00
 
 

Action details: firebolt

Static Values
  • id:3110
  • school:fire
  • resource:energy
  • range:40.0
  • travel_speed:16.0000
  • trigger_gcd:0.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.75
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:3110
  • name:Firebolt
  • school:fire
  • tooltip:
  • description:Deals {$s1=1} Fire damage to a target.$?a231795[ Damage increased by {$231795s1=50}% if you have Immolated the target.][] |cFF777777(Right-Click to toggle)|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
pet - infernal 115801 / 9807
Immolation 90190 0.8% 1.0 0.00sec 2254846 0 Periodic 46.4 41973 83896 48573 15.7% 8.1%

Stats details: immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 23.21 46.42 0.0000 1.0498 2254845.61 2254845.61 0.00 92544.45 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 39.1 84.26% 41972.71 36250 43500 41976.29 41008 43128 1641653 1641653 0.00
crit 7.3 15.74% 83896.35 72500 86999 83883.82 0 86999 613193 613193 0.00
 
 

Action details: immolation

Static Values
  • id:19483
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!ticking
Spelldata
  • id:19483
  • name:Immolation
  • school:fire
  • tooltip:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
 

Action details: immolation_tick

Static Values
  • id:20153
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all enemies near the caster.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
melee 25611 0.2% 22.0 1.11sec 29086 26355 Direct 22.0 25129 50238 29086 15.8%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.01 22.01 0.00 0.00 1.1036 0.0000 640303.37 941306.60 31.98 26355.36 26355.36
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 18.55 84.24% 25128.82 21677 26013 25129.07 24465 26013 466026 685102 31.98
crit 3.47 15.76% 50238.21 43355 52026 49018.88 0 52026 174277 256204 31.20
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
pet - doomguard 94771 / 8019
Doom Bolt 94771 0.8% 10.9 2.21sec 217277 100450 Direct 10.9 188060 375558 217311 15.6%  

Stats details: doom_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.90 10.90 0.00 0.00 2.1630 0.0000 2369312.45 2369312.45 0.00 100449.93 100449.93
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 9.20 84.40% 188059.62 181906 218287 188053.09 181906 218287 1730708 1730708 0.00
crit 1.70 15.60% 375558.06 363812 436574 315951.31 0 436574 638604 638604 0.00
 
 

Action details: doom_bolt

Static Values
  • id:85692
  • school:shadow
  • resource:energy
  • range:30.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:35.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:85692
  • name:Doom Bolt
  • school:shadow
  • tooltip:
  • description:Sends a shadowy bolt at the enemy, causing {$s1=1} Shadow damage. Deals {$s2=20}% additional damage to targets below 20% health.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
pet - lord_of_flames_infernal 115825 / 9809
Immolation 90249 0.8% 1.0 0.00sec 2256323 0 Periodic 46.4 41966 83972 48606 15.8% 8.1%

Stats details: immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 23.21 46.42 0.0000 1.0498 2256323.30 2256323.30 0.00 92605.10 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 39.1 84.19% 41965.67 36250 43500 41969.35 40863 43178 1640175 1640175 0.00
crit 7.3 15.81% 83971.60 72500 86999 83939.65 0 86999 616148 616148 0.00
 
 

Action details: immolation

Static Values
  • id:19483
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!ticking
Spelldata
  • id:19483
  • name:Immolation
  • school:fire
  • tooltip:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
 

Action details: immolation_tick

Static Values
  • id:20153
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all enemies near the caster.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
melee 25576 0.2% 22.0 1.11sec 29045 26319 Direct 22.0 25125 50276 29045 15.6%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.01 22.01 0.00 0.00 1.1036 0.0000 639419.71 940007.54 31.98 26318.98 26318.98
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 18.58 84.41% 25125.32 21677 26013 25124.87 24207 26013 466910 686401 31.98
crit 3.43 15.59% 50275.92 43355 52026 49164.02 0 52026 172510 253606 31.28
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
pet - lord_of_flames_infernal 115734 / 9802
Immolation 90161 0.8% 1.0 0.00sec 2254113 0 Periodic 46.4 41970 83922 48558 15.7% 8.1%

Stats details: immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 23.21 46.42 0.0000 1.0498 2254113.29 2254113.29 0.00 92514.40 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 39.1 84.30% 41970.30 36250 43500 41973.74 40882 43073 1642385 1642385 0.00
crit 7.3 15.70% 83922.14 72500 86999 83887.94 0 86999 611728 611728 0.00
 
 

Action details: immolation

Static Values
  • id:19483
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!ticking
Spelldata
  • id:19483
  • name:Immolation
  • school:fire
  • tooltip:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
 

Action details: immolation_tick

Static Values
  • id:20153
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all enemies near the caster.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
melee 25573 0.2% 22.0 1.11sec 29042 26316 Direct 22.0 25126 50265 29042 15.6%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.01 22.01 0.00 0.00 1.1036 0.0000 639342.53 939894.07 31.98 26315.81 26315.81
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 18.59 84.42% 25126.30 21677 26013 25126.39 24465 26013 466987 686515 31.98
crit 3.43 15.58% 50265.29 43355 52026 49095.87 0 52026 172356 253379 31.23
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
pet - lord_of_flames_infernal 115681 / 9796
Immolation 90097 0.8% 1.0 0.00sec 2252509 0 Periodic 46.4 41968 83944 48523 15.6% 8.1%

Stats details: immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 23.21 46.42 0.0000 1.0498 2252509.44 2252509.44 0.00 92448.57 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 39.2 84.38% 41968.30 36250 43500 41971.65 40882 43060 1643989 1643989 0.00
crit 7.2 15.62% 83943.67 72500 86999 83901.93 0 86999 608521 608521 0.00
 
 

Action details: immolation

Static Values
  • id:19483
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!ticking
Spelldata
  • id:19483
  • name:Immolation
  • school:fire
  • tooltip:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
 

Action details: immolation_tick

Static Values
  • id:20153
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all enemies near the caster.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
melee 25584 0.2% 22.0 1.11sec 29055 26327 Direct 22.0 25125 50275 29055 15.6%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.01 22.01 0.00 0.00 1.1036 0.0000 639625.66 940310.31 31.98 26327.46 26327.46
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 18.57 84.38% 25125.43 21677 26013 25125.45 24345 26013 466704 686099 31.98
crit 3.44 15.62% 50274.70 43355 52026 49098.86 0 52026 172922 254212 31.23
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
pet - shadowy_tear 120999 / 20665
Shadow Bolt 120999 2.1% 4.4 59.49sec 1401237 0 Periodic 48.5 110263 220600 127490 15.6% 19.9%

Stats details: shadow_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.42 0.00 48.81 48.53 0.0000 1.2306 6187315.51 6187315.51 0.00 103013.76 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 41.0 84.39% 110263.41 69 133847 110104.72 0 133847 4515654 4515654 0.00
crit 7.6 15.61% 220600.44 116 267693 217856.28 0 267693 1671661 1671661 0.00
 
 

Action details: shadow_bolt

Static Values
  • id:196657
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:196657
  • name:Shadow Bolt
  • school:shadow
  • tooltip:
  • description:Sends a shadowy bolt at the enemy, causing {$s1=1} Shadow damage.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:14.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
pet - chaos_tear 138060 / 9655
Chaos Bolt 138060 1.0% 4.4 58.45sec 656481 329940 Direct 4.4 0 660740 660740 100.0%  

Stats details: chaos_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.41 4.38 0.00 0.00 1.9898 0.0000 2893247.89 2893247.89 0.00 329940.46 329940.46
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 4.38 100.00% 660739.83 613122 774148 661241.87 0 774148 2893248 2893248 0.00
 
 

Action details: chaos_bolt

Static Values
  • id:215279
  • school:chromatic
  • resource:none
  • range:100.0
  • travel_speed:16.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:5.500
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:215279
  • name:Chaos Bolt
  • school:chromatic
  • tooltip:
  • description:Unleashes a devastating blast of chaos, causing {$s1=1} Chaos damage. Chaos Bolt always critically strikes and your critical strike chance increases its damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:5.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
pet - chaos_portal 248340 / 18710
Chaos Barrage 248340 1.9% 4.4 58.52sec 1271645 0 Periodic 153.8 31442 62881 36367 15.7% 7.9%

Stats details: chaos_barrage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.40 0.00 154.50 153.76 0.0000 0.1546 5591675.61 5591675.61 0.00 234049.46 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 129.7 84.33% 31442.27 128 36809 31371.57 0 36809 4077021 4077021 0.00
crit 24.1 15.67% 62880.70 257 73617 62718.47 0 73617 1514655 1514655 0.00
 
 

Action details: chaos_barrage

Static Values
  • id:187394
  • school:magic
  • resource:none
  • range:100.0
  • travel_speed:24.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:187394
  • name:Chaos Barrage
  • school:magic
  • tooltip:
  • description:Deals {$s1=1} Chaos damage.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:5.50
  • base_tick_time:0.25
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Simple Action Stats Execute Interval
Cloak
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Cloak
  • harmful:false
  • if_expr:
 
Berserking 2.1 180.61sec

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.08 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=15}%.
  • description:Increases your haste by {$s1=15}% for {$d=10 seconds}.
 
Dimensional Rift 13.2 23.20sec

Stats details: dimensional_rift

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.15 0.00 0.00 0.00 1.0122 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: dimensional_rift

Static Values
  • id:196586
  • school:none
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:45.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:charges=3
Spelldata
  • id:196586
  • name:Dimensional Rift
  • school:chaos
  • tooltip:
  • description:Rips a hole in time and space, opening a portal that damages your target.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Cloak
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Cloak
  • harmful:false
  • if_expr:
 
Havoc 14.9 20.91sec

Stats details: havoc

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.93 0.00 0.00 0.00 1.0687 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: havoc

Static Values
  • id:80240
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:88000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies>1&(active_enemies<4|talent.wreak_havoc.enabled&active_enemies<6)&!debuff.havoc.remains
Spelldata
  • id:80240
  • name:Havoc
  • school:shadow
  • tooltip:Spells cast by the Warlock also hit this target.
  • description:Marks a target with Havoc for {$d=8 seconds}, causing your single target spells to also strike the Havoc victim. Limit 1.
 
Life Tap 7.6 30.49sec

Stats details: life_tap

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.62 0.00 0.00 0.00 1.0491 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: life_tap

Static Values
  • id:1454
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.empowered_life_tap.enabled&!buff.empowered_life_tap.remains
Spelldata
  • id:1454
  • name:Life Tap
  • school:shadow
  • tooltip:
  • description:Restores {$s1=30}% of your maximum mana, at the cost of {$s2=10}% of your maximum health.
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Grimoire: Imp (service_imp) 3.7 91.88sec

Stats details: service_imp

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.68 0.00 0.00 0.00 0.9744 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: service_imp

Static Values
  • id:111859
  • school:shadow
  • resource:soul_shard
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:90.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:111859
  • name:Grimoire: Imp
  • school:shadow
  • tooltip:
  • description:Summons an Imp who attacks the target for {$108501s1=25} sec. Imps cast ranged Firebolts and cleanse a hostile magic effect from their master.
 
Soul Harvest 2.9 120.91sec

Stats details: soul_harvest

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.90 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: soul_harvest

Static Values
  • id:196098
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:196098
  • name:Soul Harvest
  • school:shadow
  • tooltip:Damage increased by {$s1=20}%.
  • description:Increases your damage and your pets' damage by {$s1=20}%. Lasts {$d=15 seconds}, increased by {$s2=2} sec for each target afflicted by your {$?s137043=false}[Agony][]{$?s137044=false}[Doom][]{$?s137046=false}[Immolate][], up to a maximum of {$s3=35} sec.
 
Summon Doomguard 1.0 0.00sec

Stats details: summon_doomguard

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 1.0825 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_doomguard

Static Values
  • id:18540
  • school:shadow
  • resource:soul_shard
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.grimoire_of_supremacy.enabled&active_enemies=1&artifact.lord_of_flames.rank=0
Spelldata
  • id:18540
  • name:Summon Doomguard
  • school:shadow
  • tooltip:
  • description:Summons a Doomguard for {$60478d=25 seconds} to assault the target with its Doom Bolts.
 
Summon Imp 1.0 0.00sec

Stats details: summon_imp

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_imp

Static Values
  • id:688
  • school:shadow
  • resource:soul_shard
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!talent.grimoire_of_supremacy.enabled&(!talent.grimoire_of_sacrifice.enabled|buff.demonic_power.down)
Spelldata
  • id:688
  • name:Summon Imp
  • school:shadow
  • tooltip:
  • description:Summons an Imp under your command that casts ranged Firebolts.$?s74434[ |cFFFFFFFFSoulburn:|r |cFF8282FFInstant cast.|r][]
 
Summon Infernal 1.0 0.00sec

Stats details: summon_infernal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.7583 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_infernal

Static Values
  • id:1122
  • school:shadow
  • resource:soul_shard
  • range:30.0
  • travel_speed:1.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.grimoire_of_supremacy.enabled&artifact.lord_of_flames.rank>0
Spelldata
  • id:1122
  • name:Summon Infernal
  • school:shadow
  • tooltip:
  • description:Summons an Infernal from the Twisting Nether, impacting for {$22703s1=0} Fire damage and stunning all enemy targets in the area for {$22703d=2 seconds}. The Infernal will serve you for {$111685d=25 seconds}, dealing strong area-of-effect damage.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Accelerando 20.1 0.0 15.4sec 15.4sec 78.55% 78.55% 1.4(1.4) 19.3

Buff details

  • buff initial source:Cloak
  • cooldown name:buff_accelerando
  • max_stacks:5
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:734.41

Stack Uptimes

  • accelerando_1:29.82%
  • accelerando_2:24.61%
  • accelerando_3:14.70%
  • accelerando_4:6.53%
  • accelerando_5:2.90%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225719
  • name:Accelerando
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc225125=Your damaging spells have a chance to grant you {$225719s1=528} Haste for {$225719d=12 seconds}, stacking up to 5 times. Stacking does not refresh duration.}
  • max_stacks:5
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Berserking 2.1 0.0 180.6sec 180.6sec 6.87% 8.42% 0.0(0.0) 2.0

Buff details

  • buff initial source:Cloak
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:10.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • berserking_1:6.87%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=15}%.
  • description:Increases your haste by {$s1=15}% for {$d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.55% 15.49% 0.0(0.0) 1.0

Buff details

  • buff initial source:Cloak
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:13.55%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Conflagration of Chaos 24.2 0.0 12.3sec 12.3sec 49.40% 46.93% 0.0(0.0) 1.0

Buff details

  • buff initial source:Cloak
  • cooldown name:buff_conflagration_of_chaos
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:50.00%
  • default_value:-0.00

Stack Uptimes

  • conflagration_of_chaos_1:49.40%

Trigger Attempt Success

  • trigger_pct:50.05%

Spelldata details

  • id:196546
  • name:Conflagration of Chaos
  • tooltip:Your {$?s17877=false}[Shadowburn][Conflagrate] will always critically strike. Critical strike chance will increase the critical strike damage of {$?s17877=false}[Shadowburn][Conflagrate].
  • description:{$@spelldesc219195={$?s17877=false}[Shadowburn][Conflagrate] has a chance to guarantee your next {$?s17877=false}[Shadowburn][Conflagrate] critically strikes, and to increase its damage by your critical strike chance.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Devil's Due 3.5 0.0 69.6sec 69.6sec 8.68% 10.22% 0.0(0.0) 3.2

Buff details

  • buff initial source:Cloak
  • cooldown name:buff_devils_due
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.18

Stack Uptimes

  • devils_due_1:8.68%

Trigger Attempt Success

  • trigger_pct:99.93%

Spelldata details

  • id:225776
  • name:Devil's Due
  • tooltip:Cast speed slowed by {$s1=7}%.
  • description:{$@spelldesc225142=Your damaging spells have a chance to grant Nefarious Pact, increasing your casting speed by {$225774s1=17}% for {$225774d=12 seconds}. When Nefarious Pact expires, your casting speed is decreased by {$225776s1=7}% for {$225776d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Embrace Chaos 26.2 32.3 11.7sec 5.1sec 59.27% 66.79% 32.3(32.3) 25.6

Buff details

  • buff initial source:Cloak
  • cooldown name:buff_embrace_chaos
  • max_stacks:1
  • duration:4.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • embrace_chaos_1:59.27%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:212019
  • name:Embrace Chaos
  • tooltip:Chaos Bolt has {$s1=40}% reduced cast time.
  • description:{$@spelldesc212018=Casting Chaos Bolt reduces the cast time of your next Chaos Bolt by {$212019s1=40}% for {$212019d=4 seconds}.}
  • max_stacks:0
  • duration:4.00
  • cooldown:0.00
  • default_chance:0.00%
Lord of Flames 1.0 0.0 0.0sec 0.0sec 97.87% 97.87% 0.0(0.0) 0.0

Buff details

  • buff initial source:Cloak
  • cooldown name:buff_lord_of_flames
  • max_stacks:1
  • duration:600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • lord_of_flames_1:97.87%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:226802
  • name:Lord of Flames
  • tooltip:Recently activated Lord of Flames.
  • description:{$@spelldesc224103=Once every {$s2=10} minutes, {$?s152107=false}[your Infernal's Meteor Strike][Summon Infernal] will summon {$s3=3} additional Infernals to serve you for {$226804d=25 seconds}.}
  • max_stacks:0
  • duration:600.00
  • cooldown:0.00
  • default_chance:0.00%
Nefarious Pact 3.5 0.0 69.9sec 69.2sec 13.53% 15.02% 0.0(0.0) 3.3

Buff details

  • buff initial source:Cloak
  • cooldown name:buff_nefarious_pact
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.44

Stack Uptimes

  • nefarious_pact_1:13.53%

Trigger Attempt Success

  • trigger_pct:99.93%

Spelldata details

  • id:225774
  • name:Nefarious Pact
  • tooltip:Cast speed increased by {$s1=17}%.
  • description:{$@spelldesc225142=Your damaging spells have a chance to grant Nefarious Pact, increasing your casting speed by {$225774s1=17}% for {$225774d=12 seconds}. When Nefarious Pact expires, your casting speed is decreased by {$225776s1=7}% for {$225776d=8 seconds}.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of Deadly Grace 1.0 0.0 0.0sec 0.0sec 10.16% 10.16% 0.0(0.0) 1.0

Buff details

  • buff initial source:Cloak
  • cooldown name:buff_potion_of_deadly_grace
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_deadly_grace_1:10.16%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188027
  • name:Potion of Deadly Grace
  • tooltip:Your attacks have a chance to unleash a bolt of energy at your target.
  • description:Grants your attacks a chance to unleash a bolt of energy at your target. Staying away from enemies for the entire duration of the effect will extend the effect by an additional 5 seconds.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
Potion of Prolonged Power 1.0 0.0 0.0sec 0.0sec 19.64% 19.64% 0.0(0.0) 1.0

Buff details

  • buff initial source:Cloak
  • cooldown name:buff_potion_of_prolonged_power
  • max_stacks:1
  • duration:60.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:all
  • amount:2500.00

Stack Uptimes

  • potion_of_prolonged_power_1:19.64%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:229206
  • name:Potion of Prolonged Power
  • tooltip:All stats increased by {$s1=2500}.
  • description:Drink to increase all stats by {$s1=2500} for {$d=60 seconds}.
  • max_stacks:0
  • duration:60.00
  • cooldown:1.00
  • default_chance:0.00%
Soul Harvest 2.9 0.0 120.9sec 120.9sec 17.76% 17.76% 0.0(0.0) 2.7

Buff details

  • buff initial source:Cloak
  • cooldown name:buff_soul_harvest
  • max_stacks:1
  • duration:15.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • soul_harvest_1:17.76%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:196098
  • name:Soul Harvest
  • tooltip:Damage increased by {$s1=20}%.
  • description:Increases your damage and your pets' damage by {$s1=20}%. Lasts {$d=15 seconds}, increased by {$s2=2} sec for each target afflicted by your {$?s137043=false}[Agony][]{$?s137044=false}[Doom][]{$?s137046=false}[Immolate][], up to a maximum of {$s3=35} sec.
  • max_stacks:0
  • duration:15.00
  • cooldown:120.00
  • default_chance:0.00%
Constant Buffs
Well Fed (azshari_salad)

Buff details

  • buff initial source:Cloak
  • cooldown name:buff_azshari_salad
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:375.00

Stack Uptimes

  • azshari_salad_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225603
  • name:Well Fed
  • tooltip:Haste increased by $w1.
  • description:Increases haste by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Defiled Augmentation

Buff details

  • buff initial source:Cloak
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Whispered Pact

Buff details

  • buff initial source:Cloak
  • cooldown name:buff_flask_of_the_whispered_pact
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:1300.00

Stack Uptimes

  • flask_of_the_whispered_pact_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188031
  • name:Flask of the Whispered Pact
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%

Procs

Count Interval
shadowy_tear 4.4 59.1sec
chaos_tear 4.4 58.7sec
chaos_portal 4.4 58.9sec
dimension_ripper 4.0 54.3sec

Resources

Resource Usage Type Count Total Average RPE APR
Cloak
chaos_bolt Soul Shard 58.5 117.0 2.0 2.0 816338.7
havoc Mana 14.9 1313569.1 88000.0 88000.2 0.0
immolate Mana 19.9 1315289.0 66000.0 65999.4 53.8
incinerate Mana 80.1 5284427.3 66000.0 66001.0 7.5
service_imp Soul Shard 3.7 3.7 1.0 1.0 0.0
summon_doomguard Soul Shard 1.0 1.0 1.0 1.0 0.0
summon_infernal Soul Shard 1.0 1.0 1.0 1.0 0.0
pet - imp
firebolt Energy 108.6 4344.3 40.0 40.0 2921.3
pet - service_imp
firebolt Energy 49.1 1962.2 40.0 40.0 5972.5
pet - doomguard
doom_bolt Energy 10.9 381.7 35.0 35.0 6207.9
Resource Gains Type Count Total Average Overflow
life_tap Mana 7.62 2515330.40 (35.69%) 330000.00 0.00 0.00%
immolate Soul Shard 64.85 64.32 (53.00%) 0.99 0.53 0.82%
conflagrate Soul Shard 48.32 48.27 (39.78%) 1.00 0.05 0.11%
mp5_regen Mana 475.73 4532290.78 (64.31%) 9527.05 88726.42 1.92%
soulsnatcher Soul Shard 8.76 8.76 (7.22%) 1.00 0.00 0.00%
pet - imp
energy_regen Energy 1900.72 4178.00 (100.00%) 2.20 21.57 0.51%
pet - service_imp
energy_regen Energy 441.48 1341.08 (100.00%) 3.04 61.74 4.40%
pet - doomguard
energy_regen Energy 15.58 340.87 (100.00%) 21.88 42.79 11.15%
Resource RPS-Gain RPS-Loss
Health 0.00 7972.13
Mana 23404.37 26279.10
Soul Shard 0.40 0.41
Combat End Resource Mean Min Max
Mana 234605.99 4854.05 552779.46
Soul Shard 1.64 0.00 5.00

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 1.4%

Statistics & Data Analysis

Fight Length
Sample Data Cloak Fight Length
Count 9999
Mean 301.12
Minimum 221.26
Maximum 379.15
Spread ( max - min ) 157.89
Range [ ( max - min ) / 2 * 100% ] 26.22%
DPS
Sample Data Cloak Damage Per Second
Count 9999
Mean 983612.43
Minimum 852910.92
Maximum 1173966.44
Spread ( max - min ) 321055.52
Range [ ( max - min ) / 2 * 100% ] 16.32%
Priority Target DPS
Sample Data Cloak Priority Target Damage Per Second
Count 9999
Mean 576850.78
Minimum 508726.33
Maximum 684030.51
Spread ( max - min ) 175304.18
Range [ ( max - min ) / 2 * 100% ] 15.19%
DPS(e)
Sample Data Cloak Damage Per Second (Effective)
Count 9999
Mean 983612.43
Minimum 852910.92
Maximum 1173966.44
Spread ( max - min ) 321055.52
Range [ ( max - min ) / 2 * 100% ] 16.32%
Damage
Sample Data Cloak Damage
Count 9999
Mean 242401672.14
Minimum 163697481.22
Maximum 319651877.64
Spread ( max - min ) 155954396.42
Range [ ( max - min ) / 2 * 100% ] 32.17%
DTPS
Sample Data Cloak Damage Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Cloak Healing Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS(e)
Sample Data Cloak Healing Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Cloak Heal
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Cloak Healing Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Cloak Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
ETMI
Sample Data CloakTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data Cloak Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=whispered_pact
1 0.00 food,type=azshari_salad
2 0.00 summon_pet,if=!talent.grimoire_of_supremacy.enabled&(!talent.grimoire_of_sacrifice.enabled|buff.demonic_power.down)
3 0.00 summon_infernal,if=talent.grimoire_of_supremacy.enabled&artifact.lord_of_flames.rank>0
4 0.00 summon_infernal,if=talent.grimoire_of_supremacy.enabled&active_enemies>1
5 0.00 summon_doomguard,if=talent.grimoire_of_supremacy.enabled&active_enemies=1&artifact.lord_of_flames.rank=0
6 0.00 augmentation,type=defiled
7 0.00 snapshot_stats
8 0.00 grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
9 0.00 life_tap,if=talent.empowered_life_tap.enabled&!buff.empowered_life_tap.remains
A 0.00 potion,name=prolonged_power
B 0.00 chaos_bolt
Default action list Executed every time the actor is available.
# count action,conditions
C 14.89 havoc,target=2,if=active_enemies>1&(active_enemies<4|talent.wreak_havoc.enabled&active_enemies<6)&!debuff.havoc.remains
D 1.00 dimensional_rift,if=charges=3
E 10.31 immolate,if=remains<=tick_time
F 0.63 immolate,cycle_targets=1,if=active_enemies>1&remains<=tick_time&(!talent.roaring_blaze.enabled|(!debuff.roaring_blaze.remains&action.conflagrate.charges<2))
G 9.03 immolate,if=talent.roaring_blaze.enabled&remains<=duration&!debuff.roaring_blaze.remains&target.time_to_die>10&(action.conflagrate.charges=2+set_bonus.tier19_4pc|(action.conflagrate.charges>=1+set_bonus.tier19_4pc&action.conflagrate.recharge_time<cast_time+gcd)|target.time_to_die<24)
H 2.08 berserking
0.00 blood_fury
0.00 arcane_torrent
I 1.00 potion,name=deadly_grace,if=(buff.soul_harvest.remains|trinket.proc.any.react|target.time_to_die<=45)
0.00 shadowburn,if=buff.conflagration_of_chaos.remains<=action.chaos_bolt.cast_time
0.00 shadowburn,if=(charges=1&recharge_time<action.chaos_bolt.cast_time|charges=2)&soul_shard<5
J 13.84 conflagrate,if=talent.roaring_blaze.enabled&(charges=2+set_bonus.tier19_4pc|(charges>=1+set_bonus.tier19_4pc&recharge_time<gcd)|target.time_to_die<24)
K 34.48 conflagrate,if=talent.roaring_blaze.enabled&debuff.roaring_blaze.stack>0&dot.immolate.remains>dot.immolate.duration*0.3&(active_enemies=1|soul_shard<3)&soul_shard<5
0.00 conflagrate,if=!talent.roaring_blaze.enabled&!buff.backdraft.remains&buff.conflagration_of_chaos.remains<=action.chaos_bolt.cast_time
0.00 conflagrate,if=!talent.roaring_blaze.enabled&!buff.backdraft.remains&(charges=1&recharge_time<action.chaos_bolt.cast_time|charges=2)&soul_shard<5
0.00 life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<=gcd
0.00 dimensional_rift,if=equipped.144369&!buff.lessons_of_spacetime.remains&((!talent.grimoire_of_supremacy.enabled&!cooldown.summon_doomguard.remains)|(talent.grimoire_of_service.enabled&!cooldown.service_pet.remains)|(talent.soul_harvest.enabled&!cooldown.soul_harvest.remains))
L 3.68 service_pet
M 1.00 summon_infernal,if=artifact.lord_of_flames.rank>0&!buff.lord_of_flames.remains
N 1.00 summon_doomguard,if=!talent.grimoire_of_supremacy.enabled&spell_targets.infernal_awakening<=2&(target.time_to_die>180|target.health.pct<=20|target.time_to_die<30)
0.00 summon_infernal,if=!talent.grimoire_of_supremacy.enabled&spell_targets.infernal_awakening>2
0.00 summon_doomguard,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal=1&artifact.lord_of_flames.rank>0&buff.lord_of_flames.remains&!pet.doomguard.active
0.00 summon_doomguard,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal=1&equipped.132379&!cooldown.sindorei_spite_icd.remains
0.00 summon_infernal,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal>1&equipped.132379&!cooldown.sindorei_spite_icd.remains
O 2.90 soul_harvest
0.00 channel_demonfire,if=dot.immolate.remains>cast_time
P 0.03 havoc,if=active_enemies=1&talent.wreak_havoc.enabled&equipped.132375&!debuff.havoc.remains
0.00 rain_of_fire,if=active_enemies>=3&cooldown.havoc.remains<=12&!talent.wreak_havoc.enabled
0.00 rain_of_fire,if=active_enemies>=6&talent.wreak_havoc.enabled
Q 12.15 dimensional_rift,if=!equipped.144369|charges>1|((!talent.grimoire_of_service.enabled|recharge_time<cooldown.service_pet.remains)&(!talent.soul_harvest.enabled|recharge_time<cooldown.soul_harvest.remains)&(!talent.grimoire_of_supremacy.enabled|recharge_time<cooldown.summon_doomguard.remains))
0.00 life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<duration*0.3
0.00 cataclysm
R 57.81 chaos_bolt,if=(cooldown.havoc.remains>12&cooldown.havoc.remains|active_enemies<3|talent.wreak_havoc.enabled&active_enemies<6)
0.00 shadowburn
0.00 conflagrate,if=!talent.roaring_blaze.enabled&!buff.backdraft.remains
0.00 immolate,if=!talent.roaring_blaze.enabled&remains<=duration*0.3
S 80.40 incinerate
T 7.62 life_tap

Sample Sequence

0126ABCDEGHJKLKMOQKQRSRKSQRSKRSCSSSSERSSQSGJRKKRKRSCRSSRKQRSSSRSSESSSSTCGJRKRKRKRSSSKRSSSCRSTSERQSSQSGJKKLRCKRRSKSSRSSERTRCOISSSGJRQRJKRRKRSCKSSSSTESSSSSSGJKRCKRKRSTSKQHRRSSERCLSSQGJKRKRSKRRSCKRSRSSTERSQSQRRSSSGJCKKNRFKRRKOSRSSTCERSSSSSTGJKQRKCJRRSSJLSSQJERRSJPRSS

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask Cloak 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 1 food Cloak 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 2 summon_imp Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 6 augmentation Cloak 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat A potion Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard potion_of_prolonged_power
0:00.000 precombat B chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard embrace_chaos, accelerando, potion_of_prolonged_power
0:00.000 default C havoc enemy2 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard embrace_chaos, accelerando, potion_of_prolonged_power
0:01.146 default D dimensional_rift Fluffy_Pillow 1033527.5/1100000: 94% mana | 1.0/5: 20% soul_shard bloodlust, embrace_chaos, accelerando, potion_of_prolonged_power
0:02.028 default E immolate Fluffy_Pillow 1050095.7/1100000: 95% mana | 1.0/5: 20% soul_shard bloodlust, embrace_chaos, accelerando, potion_of_prolonged_power
0:02.911 default G immolate Fluffy_Pillow 1000682.7/1100000: 91% mana | 1.0/5: 20% soul_shard bloodlust, embrace_chaos, accelerando, potion_of_prolonged_power
0:03.794 default H berserking Fluffy_Pillow 951271.2/1100000: 86% mana | 1.0/5: 20% soul_shard bloodlust, embrace_chaos, accelerando(2), potion_of_prolonged_power
0:03.794 default J conflagrate Fluffy_Pillow 951271.2/1100000: 86% mana | 1.0/5: 20% soul_shard bloodlust, berserking, embrace_chaos, accelerando(2), potion_of_prolonged_power
0:04.551 default K conflagrate Fluffy_Pillow 967868.3/1100000: 88% mana | 2.0/5: 40% soul_shard bloodlust, berserking, conflagration_of_chaos, accelerando(2), potion_of_prolonged_power
0:05.307 default L service_imp Fluffy_Pillow 984443.6/1100000: 89% mana | 3.0/5: 60% soul_shard bloodlust, berserking, accelerando(2), potion_of_prolonged_power
0:06.063 default K conflagrate Fluffy_Pillow 1001018.8/1100000: 91% mana | 2.0/5: 40% soul_shard bloodlust, berserking, accelerando(2), potion_of_prolonged_power
0:06.821 default M summon_infernal Fluffy_Pillow 1017637.9/1100000: 93% mana | 3.0/5: 60% soul_shard bloodlust, berserking, accelerando(2), potion_of_prolonged_power
0:07.578 default O soul_harvest Fluffy_Pillow 1034235.0/1100000: 94% mana | 2.0/5: 40% soul_shard bloodlust, berserking, lord_of_flames, accelerando(2), potion_of_prolonged_power
0:07.578 default Q dimensional_rift Fluffy_Pillow 1034235.0/1100000: 94% mana | 2.0/5: 40% soul_shard bloodlust, berserking, soul_harvest, lord_of_flames, accelerando(2), potion_of_prolonged_power
0:08.335 default K conflagrate Fluffy_Pillow 1050832.2/1100000: 96% mana | 2.0/5: 40% soul_shard bloodlust, berserking, soul_harvest, lord_of_flames, accelerando(2), potion_of_prolonged_power
0:09.091 default Q dimensional_rift Fluffy_Pillow 1067407.4/1100000: 97% mana | 3.0/5: 60% soul_shard bloodlust, berserking, soul_harvest, lord_of_flames, accelerando(2), potion_of_prolonged_power
0:09.847 default R chaos_bolt Fluffy_Pillow 1083982.7/1100000: 99% mana | 3.0/5: 60% soul_shard bloodlust, berserking, soul_harvest, lord_of_flames, accelerando(2), potion_of_prolonged_power
0:11.356 default S incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard bloodlust, berserking, soul_harvest, lord_of_flames, embrace_chaos, accelerando(2), potion_of_prolonged_power
0:12.265 default R chaos_bolt Fluffy_Pillow 1034127.7/1100000: 94% mana | 2.0/5: 40% soul_shard bloodlust, berserking, soul_harvest, lord_of_flames, embrace_chaos, potion_of_prolonged_power
0:13.200 default K conflagrate Fluffy_Pillow 1054025.1/1100000: 96% mana | 0.0/5: 0% soul_shard bloodlust, berserking, soul_harvest, lord_of_flames, embrace_chaos, potion_of_prolonged_power
0:13.981 default S incinerate Fluffy_Pillow 1070126.3/1100000: 97% mana | 1.0/5: 20% soul_shard bloodlust, soul_harvest, lord_of_flames, embrace_chaos, potion_of_prolonged_power
0:15.054 default Q dimensional_rift Fluffy_Pillow 1023983.3/1100000: 93% mana | 1.0/5: 20% soul_shard bloodlust, soul_harvest, lord_of_flames, embrace_chaos, accelerando, potion_of_prolonged_power
0:15.937 default R chaos_bolt Fluffy_Pillow 1040570.3/1100000: 95% mana | 2.0/5: 40% soul_shard bloodlust, soul_harvest, lord_of_flames, embrace_chaos, accelerando, potion_of_prolonged_power
0:16.995 default S incinerate Fluffy_Pillow 1060444.7/1100000: 96% mana | 1.0/5: 20% soul_shard bloodlust, soul_harvest, lord_of_flames, embrace_chaos, accelerando, potion_of_prolonged_power
0:18.054 default K conflagrate Fluffy_Pillow 1014337.8/1100000: 92% mana | 1.0/5: 20% soul_shard bloodlust, soul_harvest, lord_of_flames, embrace_chaos, accelerando, potion_of_prolonged_power
0:18.938 default R chaos_bolt Fluffy_Pillow 1030943.7/1100000: 94% mana | 2.0/5: 40% soul_shard bloodlust, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando, potion_of_prolonged_power
0:19.996 default S incinerate Fluffy_Pillow 1050819.4/1100000: 96% mana | 0.0/5: 0% soul_shard bloodlust, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2), potion_of_prolonged_power
0:21.038 default C havoc enemy2 1004820.5/1100000: 91% mana | 0.0/5: 0% soul_shard bloodlust, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3), potion_of_prolonged_power
0:21.895 default S incinerate Fluffy_Pillow 933399.2/1100000: 85% mana | 0.0/5: 0% soul_shard bloodlust, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3), potion_of_prolonged_power
0:22.924 default S incinerate Fluffy_Pillow 887491.4/1100000: 81% mana | 0.0/5: 0% soul_shard bloodlust, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(4), potion_of_prolonged_power
0:23.936 default S incinerate Fluffy_Pillow 841352.2/1100000: 76% mana | 0.0/5: 0% soul_shard bloodlust, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(4), potion_of_prolonged_power
0:24.949 default S incinerate Fluffy_Pillow 795232.6/1100000: 72% mana | 1.0/5: 20% soul_shard bloodlust, soul_harvest, lord_of_flames, conflagration_of_chaos, accelerando(4), potion_of_prolonged_power
0:25.962 default E immolate Fluffy_Pillow 749113.1/1100000: 68% mana | 2.0/5: 40% soul_shard bloodlust, soul_harvest, lord_of_flames, conflagration_of_chaos, accelerando(4), potion_of_prolonged_power
0:26.805 default R chaos_bolt Fluffy_Pillow 699658.1/1100000: 64% mana | 2.0/5: 40% soul_shard bloodlust, lord_of_flames, conflagration_of_chaos, accelerando(5), potion_of_prolonged_power
0:28.468 default S incinerate Fluffy_Pillow 730776.6/1100000: 66% mana | 1.0/5: 20% soul_shard bloodlust, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando, potion_of_prolonged_power
0:29.526 default S incinerate Fluffy_Pillow 684650.9/1100000: 62% mana | 1.0/5: 20% soul_shard bloodlust, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando, potion_of_prolonged_power
0:30.584 default Q dimensional_rift Fluffy_Pillow 638525.3/1100000: 58% mana | 1.0/5: 20% soul_shard bloodlust, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando, potion_of_prolonged_power
0:31.468 default S incinerate Fluffy_Pillow 655131.1/1100000: 60% mana | 1.0/5: 20% soul_shard bloodlust, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando, potion_of_prolonged_power
0:32.527 default G immolate Fluffy_Pillow 609024.3/1100000: 55% mana | 1.0/5: 20% soul_shard bloodlust, lord_of_flames, conflagration_of_chaos, accelerando, potion_of_prolonged_power
0:33.411 default J conflagrate Fluffy_Pillow 559630.1/1100000: 51% mana | 1.0/5: 20% soul_shard bloodlust, lord_of_flames, conflagration_of_chaos, accelerando, potion_of_prolonged_power
0:34.294 default R chaos_bolt Fluffy_Pillow 576232.3/1100000: 52% mana | 3.0/5: 60% soul_shard bloodlust, lord_of_flames, conflagration_of_chaos, accelerando(2), potion_of_prolonged_power
0:36.029 default K conflagrate Fluffy_Pillow 609310.3/1100000: 55% mana | 1.0/5: 20% soul_shard bloodlust, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2), potion_of_prolonged_power
0:36.897 default K conflagrate Fluffy_Pillow 625858.9/1100000: 57% mana | 2.0/5: 40% soul_shard bloodlust, lord_of_flames, embrace_chaos, accelerando(2), potion_of_prolonged_power
0:37.767 default R chaos_bolt Fluffy_Pillow 642445.5/1100000: 58% mana | 3.0/5: 60% soul_shard bloodlust, lord_of_flames, embrace_chaos, accelerando(2), potion_of_prolonged_power
0:38.810 default K conflagrate Fluffy_Pillow 662331.9/1100000: 60% mana | 1.0/5: 20% soul_shard bloodlust, lord_of_flames, embrace_chaos, accelerando(3), potion_of_prolonged_power
0:39.666 default R chaos_bolt Fluffy_Pillow 678891.2/1100000: 62% mana | 3.0/5: 60% soul_shard bloodlust, lord_of_flames, embrace_chaos, accelerando(3), potion_of_prolonged_power
0:40.694 default S incinerate Fluffy_Pillow 698583.0/1100000: 64% mana | 1.0/5: 20% soul_shard bloodlust, lord_of_flames, embrace_chaos, potion_of_prolonged_power
0:41.765 default C havoc enemy2 647828.3/1100000: 59% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, nefarious_pact, potion_of_prolonged_power
0:42.573 default R chaos_bolt Fluffy_Pillow 571329.8/1100000: 52% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, nefarious_pact, potion_of_prolonged_power
0:43.541 default S incinerate Fluffy_Pillow 585108.9/1100000: 53% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, nefarious_pact, potion_of_prolonged_power
0:44.508 default S incinerate Fluffy_Pillow 532873.8/1100000: 48% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, nefarious_pact, potion_of_prolonged_power
0:45.476 default R chaos_bolt Fluffy_Pillow 480652.8/1100000: 44% mana | 3.0/5: 60% soul_shard lord_of_flames, embrace_chaos, nefarious_pact, potion_of_prolonged_power
0:46.443 default K conflagrate Fluffy_Pillow 494417.7/1100000: 45% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, nefarious_pact, potion_of_prolonged_power
0:47.251 default Q dimensional_rift Fluffy_Pillow 505919.2/1100000: 46% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, nefarious_pact, potion_of_prolonged_power
0:48.059 default R chaos_bolt Fluffy_Pillow 517420.8/1100000: 47% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, nefarious_pact, potion_of_prolonged_power
0:49.026 default S incinerate Fluffy_Pillow 531186.5/1100000: 48% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, nefarious_pact, accelerando, potion_of_prolonged_power
0:49.978 default S incinerate Fluffy_Pillow 478964.5/1100000: 44% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, nefarious_pact, accelerando(2), potion_of_prolonged_power
0:50.916 default S incinerate Fluffy_Pillow 426720.8/1100000: 39% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, nefarious_pact, accelerando(2), potion_of_prolonged_power
0:51.856 default R chaos_bolt Fluffy_Pillow 374506.3/1100000: 34% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, nefarious_pact, accelerando(2), potion_of_prolonged_power
0:52.794 default S incinerate Fluffy_Pillow 388263.2/1100000: 35% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos, nefarious_pact, accelerando(3), potion_of_prolonged_power
0:53.720 default S incinerate Fluffy_Pillow 336042.8/1100000: 31% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos, nefarious_pact, accelerando(3), potion_of_prolonged_power
0:54.645 default E immolate Fluffy_Pillow 283807.6/1100000: 26% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos, devils_due, accelerando(3), potion_of_prolonged_power
0:55.956 default S incinerate Fluffy_Pillow 237317.4/1100000: 22% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos, devils_due, accelerando(4), potion_of_prolonged_power
0:57.505 default S incinerate Fluffy_Pillow 194701.7/1100000: 18% mana | 0.0/5: 0% soul_shard lord_of_flames, devils_due, accelerando(4), potion_of_prolonged_power
0:59.055 default S incinerate Fluffy_Pillow 152101.1/1100000: 14% mana | 0.0/5: 0% soul_shard lord_of_flames, devils_due, accelerando(4)
1:00.605 default S incinerate Fluffy_Pillow 109500.6/1100000: 10% mana | 0.0/5: 0% soul_shard lord_of_flames, devils_due, accelerando(4)
1:02.155 default T life_tap Fluffy_Pillow 65923.5/1100000: 6% mana | 1.0/5: 20% soul_shard lord_of_flames
1:03.318 default C havoc enemy2 412478.4/1100000: 37% mana | 1.0/5: 20% soul_shard lord_of_flames
1:04.482 default G immolate Fluffy_Pillow 341298.0/1100000: 31% mana | 2.0/5: 40% soul_shard lord_of_flames, accelerando
1:05.628 default J conflagrate Fluffy_Pillow 291858.7/1100000: 27% mana | 2.0/5: 40% soul_shard lord_of_flames, accelerando(2)
1:06.759 default R chaos_bolt Fluffy_Pillow 308445.4/1100000: 28% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, accelerando(2)
1:09.014 default K conflagrate Fluffy_Pillow 341516.1/1100000: 31% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
1:10.144 default R chaos_bolt Fluffy_Pillow 358088.1/1100000: 33% mana | 3.0/5: 60% soul_shard lord_of_flames, embrace_chaos, accelerando(2)
1:11.497 default K conflagrate Fluffy_Pillow 377930.5/1100000: 34% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando(2)
1:12.626 default R chaos_bolt Fluffy_Pillow 394487.8/1100000: 36% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
1:13.980 default K conflagrate Fluffy_Pillow 414490.0/1100000: 38% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
1:15.093 default R chaos_bolt Fluffy_Pillow 431052.3/1100000: 39% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
1:16.427 default S incinerate Fluffy_Pillow 450187.5/1100000: 41% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando
1:17.380 default S incinerate Fluffy_Pillow 397958.3/1100000: 36% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando
1:18.333 default S incinerate Fluffy_Pillow 345729.0/1100000: 31% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando
1:19.287 default K conflagrate Fluffy_Pillow 293514.2/1100000: 27% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando
1:20.082 default R chaos_bolt Fluffy_Pillow 305001.9/1100000: 28% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando
1:21.034 default S incinerate Fluffy_Pillow 318758.2/1100000: 29% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando
1:21.988 default S incinerate Fluffy_Pillow 266543.4/1100000: 24% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando
1:22.941 default S incinerate Fluffy_Pillow 214314.1/1100000: 19% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando
1:23.897 default C havoc enemy2 162129.8/1100000: 15% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(2)
1:24.680 default R chaos_bolt Fluffy_Pillow 85612.8/1100000: 8% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(2)
1:25.620 default S incinerate Fluffy_Pillow 99516.4/1100000: 9% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(3)
1:26.547 default T life_tap Fluffy_Pillow 47310.9/1100000: 4% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(3)
1:27.319 default S incinerate Fluffy_Pillow 388798.9/1100000: 35% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(3)
1:28.245 default E immolate Fluffy_Pillow 336578.5/1100000: 31% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due, accelerando(3)
1:29.555 default R chaos_bolt Fluffy_Pillow 289340.8/1100000: 26% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due
1:31.196 default Q dimensional_rift Fluffy_Pillow 312699.8/1100000: 28% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due
1:32.565 default S incinerate Fluffy_Pillow 332186.9/1100000: 30% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due
1:34.209 default S incinerate Fluffy_Pillow 289589.7/1100000: 26% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due, accelerando
1:35.827 default Q dimensional_rift Fluffy_Pillow 246969.6/1100000: 22% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, accelerando
1:36.973 default S incinerate Fluffy_Pillow 263529.2/1100000: 24% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, accelerando
1:38.350 default G immolate Fluffy_Pillow 217567.5/1100000: 20% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, accelerando(3)
1:39.462 default J conflagrate Fluffy_Pillow 168114.9/1100000: 15% mana | 0.0/5: 0% soul_shard lord_of_flames, accelerando(3)
1:40.576 default K conflagrate Fluffy_Pillow 184692.1/1100000: 17% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, accelerando(3)
1:41.688 default K conflagrate Fluffy_Pillow 201239.6/1100000: 18% mana | 2.0/5: 40% soul_shard lord_of_flames, accelerando(3)
1:42.799 default L service_imp Fluffy_Pillow 218011.7/1100000: 20% mana | 3.0/5: 60% soul_shard lord_of_flames, accelerando(4)
1:43.894 default R chaos_bolt Fluffy_Pillow 234542.2/1100000: 21% mana | 2.0/5: 40% soul_shard lord_of_flames, accelerando(4)
1:46.084 default C havoc enemy2 267975.4/1100000: 24% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos, accelerando(5)
1:47.164 default K conflagrate Fluffy_Pillow 195478.0/1100000: 18% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos
1:48.328 default R chaos_bolt Fluffy_Pillow 212047.1/1100000: 19% mana | 3.0/5: 60% soul_shard lord_of_flames, embrace_chaos
1:49.721 default R chaos_bolt Fluffy_Pillow 231875.8/1100000: 21% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos
1:51.115 default S incinerate Fluffy_Pillow 251719.7/1100000: 23% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos, accelerando
1:52.489 default K conflagrate Fluffy_Pillow 205573.9/1100000: 19% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos, accelerando
1:53.636 default S incinerate Fluffy_Pillow 222185.8/1100000: 20% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando(2)
1:54.990 default S incinerate Fluffy_Pillow 176042.9/1100000: 16% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando(2)
1:56.346 default R chaos_bolt Fluffy_Pillow 129929.3/1100000: 12% mana | 2.0/5: 40% soul_shard lord_of_flames, accelerando(2)
1:58.601 default S incinerate Fluffy_Pillow 163000.0/1100000: 15% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando(2)
1:59.955 default S incinerate Fluffy_Pillow 116857.1/1100000: 11% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando(2)
2:01.310 default E immolate Fluffy_Pillow 70729.9/1100000: 6% mana | 3.0/5: 60% soul_shard lord_of_flames, embrace_chaos, accelerando(3)
2:02.423 default R chaos_bolt Fluffy_Pillow 21293.3/1100000: 2% mana | 3.0/5: 60% soul_shard lord_of_flames, embrace_chaos, accelerando(4)
2:03.738 default T life_tap Fluffy_Pillow 40604.7/1100000: 4% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos
2:04.902 default R chaos_bolt Fluffy_Pillow 387173.8/1100000: 35% mana | 3.0/5: 60% soul_shard lord_of_flames, embrace_chaos
2:06.299 default C havoc enemy2 407059.5/1100000: 37% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos
2:07.463 default O soul_harvest Fluffy_Pillow 335628.6/1100000: 31% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos
2:07.578 default I potion Fluffy_Pillow 337265.5/1100000: 31% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, embrace_chaos
2:07.578 default S incinerate Fluffy_Pillow 337265.5/1100000: 31% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, embrace_chaos, potion_of_deadly_grace
2:08.972 default S incinerate Fluffy_Pillow 291108.6/1100000: 26% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, embrace_chaos, potion_of_deadly_grace
2:10.367 default S incinerate Fluffy_Pillow 244965.8/1100000: 22% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, potion_of_deadly_grace
2:11.760 default G immolate Fluffy_Pillow 198794.6/1100000: 18% mana | 2.0/5: 40% soul_shard soul_harvest, lord_of_flames, potion_of_deadly_grace
2:12.922 default J conflagrate Fluffy_Pillow 149335.8/1100000: 14% mana | 2.0/5: 40% soul_shard soul_harvest, lord_of_flames, accelerando, potion_of_deadly_grace
2:14.069 default R chaos_bolt Fluffy_Pillow 165909.8/1100000: 15% mana | 3.0/5: 60% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, accelerando, potion_of_deadly_grace
2:16.355 default Q dimensional_rift Fluffy_Pillow 198975.1/1100000: 18% mana | 3.0/5: 60% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2), potion_of_deadly_grace
2:17.486 default R chaos_bolt Fluffy_Pillow 215561.7/1100000: 20% mana | 3.0/5: 60% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2), potion_of_deadly_grace
2:18.840 default J conflagrate Fluffy_Pillow 235418.8/1100000: 21% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2), potion_of_deadly_grace
2:19.970 default K conflagrate Fluffy_Pillow 251990.8/1100000: 23% mana | 2.0/5: 40% soul_shard soul_harvest, lord_of_flames, embrace_chaos, accelerando(2), potion_of_deadly_grace
2:21.098 default R chaos_bolt Fluffy_Pillow 268533.5/1100000: 24% mana | 5.0/5: 100% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2), potion_of_deadly_grace
2:22.454 default R chaos_bolt Fluffy_Pillow 288421.2/1100000: 26% mana | 3.0/5: 60% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3), potion_of_deadly_grace
2:23.789 default K conflagrate Fluffy_Pillow 308287.1/1100000: 28% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3), potion_of_deadly_grace
2:24.902 default R chaos_bolt Fluffy_Pillow 324849.4/1100000: 30% mana | 2.0/5: 40% soul_shard soul_harvest, lord_of_flames, embrace_chaos, accelerando(3), potion_of_deadly_grace
2:26.237 default S incinerate Fluffy_Pillow 343864.6/1100000: 31% mana | 0.0/5: 0% soul_shard soul_harvest, lord_of_flames, embrace_chaos, accelerando, potion_of_deadly_grace
2:27.611 default C havoc enemy2 297718.8/1100000: 27% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos, accelerando, potion_of_deadly_grace
2:28.756 default K conflagrate Fluffy_Pillow 226263.9/1100000: 21% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos, accelerando, potion_of_deadly_grace
2:29.902 default S incinerate Fluffy_Pillow 242823.5/1100000: 22% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando, potion_of_deadly_grace
2:31.275 default S incinerate Fluffy_Pillow 196663.2/1100000: 18% mana | 1.0/5: 20% soul_shard lord_of_flames, accelerando, potion_of_deadly_grace
2:32.649 default S incinerate Fluffy_Pillow 150517.4/1100000: 14% mana | 1.0/5: 20% soul_shard lord_of_flames, accelerando, potion_of_deadly_grace
2:34.024 default S incinerate Fluffy_Pillow 104386.0/1100000: 9% mana | 1.0/5: 20% soul_shard lord_of_flames, accelerando, potion_of_deadly_grace
2:35.399 default T life_tap Fluffy_Pillow 58255.6/1100000: 5% mana | 1.0/5: 20% soul_shard lord_of_flames, accelerando(2), potion_of_deadly_grace
2:36.529 default E immolate Fluffy_Pillow 404827.7/1100000: 37% mana | 1.0/5: 20% soul_shard lord_of_flames, accelerando(2), potion_of_deadly_grace
2:37.659 default S incinerate Fluffy_Pillow 355399.7/1100000: 32% mana | 1.0/5: 20% soul_shard lord_of_flames, accelerando(2)
2:39.014 default S incinerate Fluffy_Pillow 308934.4/1100000: 28% mana | 1.0/5: 20% soul_shard lord_of_flames
2:40.410 default S incinerate Fluffy_Pillow 262805.9/1100000: 24% mana | 1.0/5: 20% soul_shard lord_of_flames
2:41.805 default S incinerate Fluffy_Pillow 216663.2/1100000: 20% mana | 1.0/5: 20% soul_shard lord_of_flames
2:43.200 default S incinerate Fluffy_Pillow 170520.4/1100000: 16% mana | 1.0/5: 20% soul_shard lord_of_flames
2:44.596 default S incinerate Fluffy_Pillow 124404.0/1100000: 11% mana | 1.0/5: 20% soul_shard lord_of_flames, accelerando
2:45.970 default G immolate Fluffy_Pillow 78258.1/1100000: 7% mana | 1.0/5: 20% soul_shard lord_of_flames, accelerando
2:47.116 default J conflagrate Fluffy_Pillow 28880.9/1100000: 3% mana | 1.0/5: 20% soul_shard lord_of_flames, accelerando(2)
2:48.245 default K conflagrate Fluffy_Pillow 45438.2/1100000: 4% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, accelerando(2)
2:49.376 default R chaos_bolt Fluffy_Pillow 62268.4/1100000: 6% mana | 4.0/5: 80% soul_shard lord_of_flames, conflagration_of_chaos, accelerando(3)
2:51.597 default C havoc enemy2 95318.6/1100000: 9% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
2:52.710 default K conflagrate Fluffy_Pillow 23881.0/1100000: 2% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
2:53.824 default R chaos_bolt Fluffy_Pillow 40458.2/1100000: 4% mana | 3.0/5: 60% soul_shard lord_of_flames, embrace_chaos, accelerando(3)
2:55.160 default K conflagrate Fluffy_Pillow 60338.9/1100000: 5% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando(3)
2:56.272 default R chaos_bolt Fluffy_Pillow 76997.4/1100000: 7% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(4)
2:57.586 default S incinerate Fluffy_Pillow 95932.6/1100000: 9% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
2:58.980 default T life_tap Fluffy_Pillow 49775.6/1100000: 5% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
3:00.144 default S incinerate Fluffy_Pillow 396344.7/1100000: 36% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
3:01.538 default K conflagrate Fluffy_Pillow 350187.7/1100000: 32% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
3:02.702 default Q dimensional_rift Fluffy_Pillow 366756.8/1100000: 33% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos
3:03.865 default H berserking Fluffy_Pillow 383311.6/1100000: 35% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos
3:03.865 default R chaos_bolt Fluffy_Pillow 383311.6/1100000: 35% mana | 2.0/5: 40% soul_shard berserking, lord_of_flames, conflagration_of_chaos
3:05.884 default R chaos_bolt Fluffy_Pillow 416606.3/1100000: 38% mana | 2.0/5: 40% soul_shard berserking, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
3:07.079 default S incinerate Fluffy_Pillow 436464.1/1100000: 40% mana | 1.0/5: 20% soul_shard berserking, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
3:08.275 default S incinerate Fluffy_Pillow 390338.5/1100000: 35% mana | 1.0/5: 20% soul_shard berserking, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
3:09.470 default E immolate Fluffy_Pillow 344196.2/1100000: 31% mana | 2.0/5: 40% soul_shard berserking, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
3:10.466 default R chaos_bolt Fluffy_Pillow 294747.1/1100000: 27% mana | 2.0/5: 40% soul_shard berserking, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
3:11.659 default C havoc enemy2 314571.7/1100000: 29% mana | 0.0/5: 0% soul_shard berserking, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
3:12.657 default L service_imp Fluffy_Pillow 243195.7/1100000: 22% mana | 1.0/5: 20% soul_shard berserking, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
3:13.781 default S incinerate Fluffy_Pillow 262152.3/1100000: 24% mana | 0.0/5: 0% soul_shard berserking, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
3:14.961 default S incinerate Fluffy_Pillow 213752.0/1100000: 19% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
3:16.294 default Q dimensional_rift Fluffy_Pillow 167588.8/1100000: 15% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, accelerando(4)
3:17.390 default G immolate Fluffy_Pillow 183710.4/1100000: 17% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos
3:18.556 default J conflagrate Fluffy_Pillow 134307.9/1100000: 12% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos
3:19.720 default K conflagrate Fluffy_Pillow 150877.0/1100000: 14% mana | 2.0/5: 40% soul_shard lord_of_flames
3:20.883 default R chaos_bolt Fluffy_Pillow 167431.8/1100000: 15% mana | 3.0/5: 60% soul_shard lord_of_flames
3:23.205 default K conflagrate Fluffy_Pillow 200916.0/1100000: 18% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando
3:24.352 default R chaos_bolt Fluffy_Pillow 217490.0/1100000: 20% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
3:25.726 default S incinerate Fluffy_Pillow 237344.2/1100000: 22% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
3:27.100 default K conflagrate Fluffy_Pillow 191198.3/1100000: 17% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
3:28.247 default R chaos_bolt Fluffy_Pillow 207772.4/1100000: 19% mana | 5.0/5: 100% soul_shard lord_of_flames, embrace_chaos, accelerando
3:29.622 default R chaos_bolt Fluffy_Pillow 227642.2/1100000: 21% mana | 3.0/5: 60% soul_shard lord_of_flames, embrace_chaos, accelerando(2)
3:30.977 default S incinerate Fluffy_Pillow 247651.8/1100000: 23% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando(3)
3:32.312 default C havoc enemy2 201518.7/1100000: 18% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando(4)
3:33.408 default K conflagrate Fluffy_Pillow 129886.0/1100000: 12% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos
3:34.572 default R chaos_bolt Fluffy_Pillow 146455.1/1100000: 13% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos
3:35.965 default S incinerate Fluffy_Pillow 166283.8/1100000: 15% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos
3:37.360 default R chaos_bolt Fluffy_Pillow 120199.6/1100000: 11% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando
3:38.734 default S incinerate Fluffy_Pillow 140053.8/1100000: 13% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos, accelerando
3:40.108 default S incinerate Fluffy_Pillow 93908.0/1100000: 9% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, nefarious_pact, accelerando
3:41.060 default T life_tap Fluffy_Pillow 41664.2/1100000: 4% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, nefarious_pact, accelerando
3:41.855 default E immolate Fluffy_Pillow 383151.9/1100000: 35% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, nefarious_pact, accelerando
3:42.651 default R chaos_bolt Fluffy_Pillow 328654.0/1100000: 30% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, nefarious_pact, accelerando
3:43.606 default S incinerate Fluffy_Pillow 342453.7/1100000: 31% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos, nefarious_pact, accelerando
3:44.559 default Q dimensional_rift Fluffy_Pillow 290224.4/1100000: 26% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos, nefarious_pact, accelerando
3:45.354 default S incinerate Fluffy_Pillow 301712.1/1100000: 27% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos, nefarious_pact, accelerando
3:46.308 default Q dimensional_rift Fluffy_Pillow 249497.3/1100000: 23% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, nefarious_pact, accelerando
3:47.104 default R chaos_bolt Fluffy_Pillow 260999.4/1100000: 24% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, nefarious_pact, accelerando
3:48.058 default R chaos_bolt Fluffy_Pillow 274784.6/1100000: 25% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, nefarious_pact, accelerando
3:49.012 default S incinerate Fluffy_Pillow 288578.0/1100000: 26% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos, nefarious_pact, accelerando(2)
3:49.953 default S incinerate Fluffy_Pillow 236005.5/1100000: 21% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos, nefarious_pact
3:50.920 default S incinerate Fluffy_Pillow 183770.3/1100000: 17% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos, nefarious_pact
3:51.887 default G immolate Fluffy_Pillow 131535.2/1100000: 12% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos, devils_due
3:53.257 default J conflagrate Fluffy_Pillow 85036.6/1100000: 8% mana | 0.0/5: 0% soul_shard lord_of_flames, devils_due
3:54.626 default C havoc enemy2 104523.7/1100000: 10% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, devils_due
3:55.994 default K conflagrate Fluffy_Pillow 36291.2/1100000: 3% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, devils_due, accelerando
3:57.345 default K conflagrate Fluffy_Pillow 55813.0/1100000: 5% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, devils_due, accelerando
3:58.694 default N summon_doomguard Fluffy_Pillow 75305.9/1100000: 7% mana | 4.0/5: 80% soul_shard lord_of_flames, devils_due, accelerando
4:00.043 default R chaos_bolt Fluffy_Pillow 94798.8/1100000: 9% mana | 3.0/5: 60% soul_shard lord_of_flames, accelerando
4:02.329 default F immolate enemy2 128279.7/1100000: 12% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando(3)
4:03.441 default K conflagrate Fluffy_Pillow 79024.6/1100000: 7% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando(4)
4:04.539 default R chaos_bolt Fluffy_Pillow 95600.5/1100000: 9% mana | 3.0/5: 60% soul_shard lord_of_flames, embrace_chaos, accelerando(4)
4:05.856 default R chaos_bolt Fluffy_Pillow 115482.4/1100000: 10% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando(4)
4:07.171 default K conflagrate Fluffy_Pillow 134864.5/1100000: 12% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos
4:08.335 default O soul_harvest Fluffy_Pillow 151433.6/1100000: 14% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos
4:08.335 default S incinerate Fluffy_Pillow 151433.6/1100000: 14% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, embrace_chaos
4:09.728 default R chaos_bolt Fluffy_Pillow 105262.3/1100000: 10% mana | 2.0/5: 40% soul_shard soul_harvest, lord_of_flames, embrace_chaos
4:11.124 default S incinerate Fluffy_Pillow 125135.1/1100000: 11% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, embrace_chaos, accelerando
4:12.499 default S incinerate Fluffy_Pillow 79003.7/1100000: 7% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, embrace_chaos, accelerando
4:13.873 default T life_tap Fluffy_Pillow 32857.9/1100000: 3% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, embrace_chaos, accelerando
4:15.021 default C havoc enemy2 379446.4/1100000: 34% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, embrace_chaos, accelerando
4:16.166 default E immolate Fluffy_Pillow 307991.5/1100000: 28% mana | 2.0/5: 40% soul_shard soul_harvest, lord_of_flames, accelerando
4:17.313 default R chaos_bolt Fluffy_Pillow 258565.5/1100000: 24% mana | 2.0/5: 40% soul_shard soul_harvest, lord_of_flames, accelerando
4:19.600 default S incinerate Fluffy_Pillow 291678.8/1100000: 27% mana | 0.0/5: 0% soul_shard soul_harvest, lord_of_flames, embrace_chaos, accelerando(2)
4:20.955 default S incinerate Fluffy_Pillow 245551.6/1100000: 22% mana | 0.0/5: 0% soul_shard soul_harvest, lord_of_flames, embrace_chaos, accelerando(3)
4:22.288 default S incinerate Fluffy_Pillow 199387.8/1100000: 18% mana | 0.0/5: 0% soul_shard soul_harvest, lord_of_flames, embrace_chaos, accelerando(3)
4:23.623 default S incinerate Fluffy_Pillow 152927.3/1100000: 14% mana | 0.0/5: 0% soul_shard soul_harvest, lord_of_flames
4:25.017 default S incinerate Fluffy_Pillow 106770.3/1100000: 10% mana | 0.0/5: 0% soul_shard soul_harvest, lord_of_flames
4:26.411 default T life_tap Fluffy_Pillow 60613.3/1100000: 6% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames
4:27.575 default G immolate Fluffy_Pillow 407182.4/1100000: 37% mana | 1.0/5: 20% soul_shard lord_of_flames
4:28.739 default J conflagrate Fluffy_Pillow 357751.4/1100000: 33% mana | 1.0/5: 20% soul_shard lord_of_flames
4:29.902 default K conflagrate Fluffy_Pillow 374306.3/1100000: 34% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos
4:31.066 default Q dimensional_rift Fluffy_Pillow 391125.9/1100000: 36% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, accelerando
4:32.292 default R chaos_bolt Fluffy_Pillow 408841.5/1100000: 37% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, accelerando
4:34.579 default K conflagrate Fluffy_Pillow 442222.6/1100000: 40% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
4:35.707 default C havoc enemy2 458765.3/1100000: 42% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
4:36.837 default J conflagrate Fluffy_Pillow 387337.3/1100000: 35% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
4:37.967 default R chaos_bolt Fluffy_Pillow 403909.3/1100000: 37% mana | 4.0/5: 80% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
4:39.321 default R chaos_bolt Fluffy_Pillow 423766.4/1100000: 39% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
4:40.674 default S incinerate Fluffy_Pillow 443608.8/1100000: 40% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
4:42.027 default S incinerate Fluffy_Pillow 397398.0/1100000: 36% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
4:43.402 default J conflagrate Fluffy_Pillow 351267.6/1100000: 32% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
4:44.531 default L service_imp Fluffy_Pillow 367825.0/1100000: 33% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
4:45.660 default S incinerate Fluffy_Pillow 384382.3/1100000: 35% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, accelerando(2)
4:47.013 default S incinerate Fluffy_Pillow 338224.7/1100000: 31% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, accelerando(2)
4:48.368 default Q dimensional_rift Fluffy_Pillow 292096.5/1100000: 27% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, accelerando(2)
4:49.497 default J conflagrate Fluffy_Pillow 308653.8/1100000: 28% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, accelerando(2)
4:50.627 default E immolate Fluffy_Pillow 325225.8/1100000: 30% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, accelerando(2)
4:51.758 default R chaos_bolt Fluffy_Pillow 275955.3/1100000: 25% mana | 4.0/5: 80% soul_shard lord_of_flames, conflagration_of_chaos, accelerando(3)
4:53.978 default R chaos_bolt Fluffy_Pillow 308991.3/1100000: 28% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(4)
4:55.294 default S incinerate Fluffy_Pillow 327763.6/1100000: 30% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
4:56.688 default J conflagrate Fluffy_Pillow 281610.7/1100000: 26% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
4:57.833 default P havoc Fluffy_Pillow 298155.9/1100000: 27% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
4:58.978 default R chaos_bolt Fluffy_Pillow 226701.0/1100000: 21% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
5:00.351 default S incinerate Fluffy_Pillow 246540.7/1100000: 22% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando
5:01.302 default S incinerate Fluffy_Pillow 194289.4/1100000: 18% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(2)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4201 3876 0
Agility 7254 6929 0
Stamina 52473 52473 34105
Intellect 50293 48587 38950
Spirit 1 1 0
Health 3148380 3148380 0
Mana 1100000 1100000 0
Soul Shard 5 5 0
Spell Power 50293 48587 0
Crit 15.68% 15.68% 4271
Haste 29.41% 28.41% 10652
Damage / Heal Versatility 5.39% 5.39% 2559
ManaReg per Second 14235 14125 0
Mastery 66.15% 66.15% 5618
Armor 1975 1975 1975
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 906.00
Local Head Eyes of Azj'Aqir
ilevel: 900, stats: { 253 Armor, +3255 Sta, +2170 Int, +1074 Haste, +578 Vers }
Local Neck Radiant String of Scorpid Eyes
ilevel: 900, stats: { +1831 Sta, +2011 Haste, +922 Crit }, enchant: mark_of_the_hidden_satyr
Local Shoulders Pauldrons of Azj'Aqir
ilevel: 900, stats: { 233 Armor, +2442 Sta, +1628 Int, +752 Mastery, +487 Vers }
Local Chest Robes of Fluctuating Energy
ilevel: 900, stats: { 311 Armor, +3255 Sta, +2170 Int, +1145 Haste, +507 Mastery }
Local Waist Man'ari Skullbuckled Cinch
ilevel: 900, stats: { 175 Armor, +2442 Sta, +1628 Int, +699 Haste, +540 Mastery }
Local Legs Leggings of Azj'Aqir
ilevel: 900, stats: { 272 Armor, +3255 Sta, +2170 Int, +932 Crit, +720 Haste }
Local Feet Outcast Wanderer's Footrags
ilevel: 910, stats: { 222 Armor, +2680 Sta, +1786 Int, +864 Crit, +422 Mastery }
Local Wrists Woven Lasher Tendril Bracers
ilevel: 900, stats: { 136 Armor, +1831 Sta, +1221 Int, +644 Haste, +285 Vers }
Local Hands Clutch of Azj'Aqir
ilevel: 900, stats: { 194 Armor, +2442 Sta, +1628 Int, +859 Crit, +380 Mastery }
Local Finger1 Ring of the Scoured Clan
ilevel: 900, stats: { +1831 Sta, +2095 Mastery, +838 Haste }, enchant: { +200 Haste }
Local Finger2 Ring of Braided Stems
ilevel: 905, stats: { +1918 Sta, +1814 Haste, +1209 Vers }, enchant: { +200 Haste }
Local Trinket1 Whispers in the Dark
ilevel: 905, stats: { +2162 Int }
Local Trinket2 Erratic Metronome
ilevel: 900, stats: { +2063 Int }
Local Back Odr, Shawl of the Ymirjar
ilevel: 940, stats: { 179 Armor, +2658 Sta, +1772 Int, +694 Crit, +385 Haste }, enchant: { +200 Int }
Local Main Hand Scepter of Sargeras
ilevel: 929, weapon: { 7005 - 10509, 3.6 }, stats: { +2843 Int, +4265 Sta, +922 Haste, +922 Mastery, +15509 Int }, relics: { +61 ilevels, +59 ilevels, +61 ilevels }

Talents

Level
15 Backdraft (Destruction Warlock) Roaring Blaze (Destruction Warlock) Shadowburn (Destruction Warlock)
30 Reverse Entropy (Destruction Warlock) Eradication (Destruction Warlock) Empowered Life Tap
45 Demonic Circle Mortal Coil Shadowfury
60 Cataclysm (Destruction Warlock) Fire and Brimstone (Destruction Warlock) Soul Harvest
75 Demon Skin Burning Rush Dark Pact
90 Grimoire of Supremacy Grimoire of Service Grimoire of Sacrifice
100 Wreak Havoc (Destruction Warlock) Channel Demonfire (Destruction Warlock) Soul Conduit

Profile

warlock="Cloak"
level=110
race=troll
role=spell
position=back
talents=2203021
artifact=38:142513:142516:142513:0:803:1:804:3:805:3:806:5:807:3:808:3:809:4:810:3:811:3:812:3:813:1:814:1:815:1:816:1:817:1:818:1:1355:1
spec=destruction

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,type=whispered_pact
actions.precombat+=/food,type=azshari_salad
actions.precombat+=/summon_pet,if=!talent.grimoire_of_supremacy.enabled&(!talent.grimoire_of_sacrifice.enabled|buff.demonic_power.down)
actions.precombat+=/summon_infernal,if=talent.grimoire_of_supremacy.enabled&artifact.lord_of_flames.rank>0
actions.precombat+=/summon_infernal,if=talent.grimoire_of_supremacy.enabled&active_enemies>1
actions.precombat+=/summon_doomguard,if=talent.grimoire_of_supremacy.enabled&active_enemies=1&artifact.lord_of_flames.rank=0
actions.precombat+=/augmentation,type=defiled
actions.precombat+=/snapshot_stats
actions.precombat+=/grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
actions.precombat+=/life_tap,if=talent.empowered_life_tap.enabled&!buff.empowered_life_tap.remains
actions.precombat+=/potion,name=prolonged_power
actions.precombat+=/chaos_bolt

# Executed every time the actor is available.
actions=havoc,target=2,if=active_enemies>1&(active_enemies<4|talent.wreak_havoc.enabled&active_enemies<6)&!debuff.havoc.remains
actions+=/dimensional_rift,if=charges=3
actions+=/immolate,if=remains<=tick_time
actions+=/immolate,cycle_targets=1,if=active_enemies>1&remains<=tick_time&(!talent.roaring_blaze.enabled|(!debuff.roaring_blaze.remains&action.conflagrate.charges<2))
actions+=/immolate,if=talent.roaring_blaze.enabled&remains<=duration&!debuff.roaring_blaze.remains&target.time_to_die>10&(action.conflagrate.charges=2+set_bonus.tier19_4pc|(action.conflagrate.charges>=1+set_bonus.tier19_4pc&action.conflagrate.recharge_time<cast_time+gcd)|target.time_to_die<24)
actions+=/berserking
actions+=/blood_fury
actions+=/arcane_torrent
actions+=/potion,name=deadly_grace,if=(buff.soul_harvest.remains|trinket.proc.any.react|target.time_to_die<=45)
actions+=/shadowburn,if=buff.conflagration_of_chaos.remains<=action.chaos_bolt.cast_time
actions+=/shadowburn,if=(charges=1&recharge_time<action.chaos_bolt.cast_time|charges=2)&soul_shard<5
actions+=/conflagrate,if=talent.roaring_blaze.enabled&(charges=2+set_bonus.tier19_4pc|(charges>=1+set_bonus.tier19_4pc&recharge_time<gcd)|target.time_to_die<24)
actions+=/conflagrate,if=talent.roaring_blaze.enabled&debuff.roaring_blaze.stack>0&dot.immolate.remains>dot.immolate.duration*0.3&(active_enemies=1|soul_shard<3)&soul_shard<5
actions+=/conflagrate,if=!talent.roaring_blaze.enabled&!buff.backdraft.remains&buff.conflagration_of_chaos.remains<=action.chaos_bolt.cast_time
actions+=/conflagrate,if=!talent.roaring_blaze.enabled&!buff.backdraft.remains&(charges=1&recharge_time<action.chaos_bolt.cast_time|charges=2)&soul_shard<5
actions+=/life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<=gcd
actions+=/dimensional_rift,if=equipped.144369&!buff.lessons_of_spacetime.remains&((!talent.grimoire_of_supremacy.enabled&!cooldown.summon_doomguard.remains)|(talent.grimoire_of_service.enabled&!cooldown.service_pet.remains)|(talent.soul_harvest.enabled&!cooldown.soul_harvest.remains))
actions+=/service_pet
actions+=/summon_infernal,if=artifact.lord_of_flames.rank>0&!buff.lord_of_flames.remains
actions+=/summon_doomguard,if=!talent.grimoire_of_supremacy.enabled&spell_targets.infernal_awakening<=2&(target.time_to_die>180|target.health.pct<=20|target.time_to_die<30)
actions+=/summon_infernal,if=!talent.grimoire_of_supremacy.enabled&spell_targets.infernal_awakening>2
actions+=/summon_doomguard,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal=1&artifact.lord_of_flames.rank>0&buff.lord_of_flames.remains&!pet.doomguard.active
actions+=/summon_doomguard,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal=1&equipped.132379&!cooldown.sindorei_spite_icd.remains
actions+=/summon_infernal,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal>1&equipped.132379&!cooldown.sindorei_spite_icd.remains
actions+=/soul_harvest
actions+=/channel_demonfire,if=dot.immolate.remains>cast_time
actions+=/havoc,if=active_enemies=1&talent.wreak_havoc.enabled&equipped.132375&!debuff.havoc.remains
actions+=/rain_of_fire,if=active_enemies>=3&cooldown.havoc.remains<=12&!talent.wreak_havoc.enabled
actions+=/rain_of_fire,if=active_enemies>=6&talent.wreak_havoc.enabled
actions+=/dimensional_rift,if=!equipped.144369|charges>1|((!talent.grimoire_of_service.enabled|recharge_time<cooldown.service_pet.remains)&(!talent.soul_harvest.enabled|recharge_time<cooldown.soul_harvest.remains)&(!talent.grimoire_of_supremacy.enabled|recharge_time<cooldown.summon_doomguard.remains))
actions+=/life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<duration*0.3
actions+=/cataclysm
actions+=/chaos_bolt,if=(cooldown.havoc.remains>12&cooldown.havoc.remains|active_enemies<3|talent.wreak_havoc.enabled&active_enemies<6)
actions+=/shadowburn
actions+=/conflagrate,if=!talent.roaring_blaze.enabled&!buff.backdraft.remains
actions+=/immolate,if=!talent.roaring_blaze.enabled&remains<=duration*0.3
actions+=/incinerate
actions+=/life_tap

head=eyes_of_azjaqir,id=138314,bonus_id=3445
neck=radiant_string_of_scorpid_eyes,id=140898,bonus_id=3445,enchant_id=5439
shoulders=pauldrons_of_azjaqir,id=138323,bonus_id=3445
back=odr_shawl_of_the_ymirjar,id=132375,ilevel=940,enchant_id=5436
chest=robes_of_fluctuating_energy,id=140848,bonus_id=3445
wrists=woven_lasher_tendril_bracers,id=140886,bonus_id=3445
hands=clutch_of_azjaqir,id=138311,bonus_id=3445
waist=manari_skullbuckled_cinch,id=140887,bonus_id=3445
legs=leggings_of_azjaqir,id=138317,bonus_id=3445
feet=outcast_wanderers_footrags,id=140914,bonus_id=3519
finger1=ring_of_the_scoured_clan,id=140897,bonus_id=3445,enchant=binding_of_haste
finger2=ring_of_braided_stems,id=140896,bonus_id=3518,enchant=binding_of_haste
trinket1=whispers_in_the_dark,id=140809,ilevel=905
trinket2=erratic_metronome,id=140792,ilevel=900
main_hand=scepter_of_sargeras,id=128941,ilevel=929,gem_id=140826/140837/140826,relic_id=3519/3518:3518/3519

# Gear Summary
# gear_ilvl=905.93
# gear_stamina=34105
# gear_intellect=38950
# gear_crit_rating=4271
# gear_haste_rating=10652
# gear_mastery_rating=5618
# gear_versatility_rating=2559
# gear_armor=1975
# set_bonus=tier19_2pc=1
# set_bonus=tier19_4pc=1
default_pet=imp

Feretory : 1040045 dps, 604965 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
1040044.6 1040044.6 0.0 / 0.000% 0.0 / 0.0% 34.8
RPS Out RPS In Primary Resource Waiting APM Active Skill
24765.9 24765.9 Mana 0.00% 51.2 100.0% 100%
Talents
  • 15: Roaring Blaze (Destruction Warlock)
  • 30: Eradication (Destruction Warlock)
  • 60: Soul Harvest
  • 90: Grimoire of Service
  • 100: Wreak Havoc (Destruction Warlock)
  • Talent Calculator
Artifact

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Feretory 1040045
Chaos Bolt 382143 36.8% 68.6 4.26sec 1674215 1160018 Direct 131.5 0 873921 873921 100.0%  

Stats details: chaos_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 68.63 131.48 0.00 0.00 1.4433 0.0000 114906697.94 114906697.94 0.00 1160017.54 1160017.54
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 131.48 100.00% 873921.14 567623 1337919 874212.34 822661 937285 114906698 114906698 0.00
 
 

Action details: chaos_bolt

Static Values
  • id:116858
  • school:chromatic
  • resource:soul_shard
  • range:40.0
  • travel_speed:16.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:2.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:116858
  • name:Chaos Bolt
  • school:chromatic
  • tooltip:
  • description:Unleashes a devastating blast of chaos, causing {$s1=1} Chaos damage. Chaos Bolt always critically strikes and your critical strike chance increases its damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:4.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Conflagrate 108621 10.5% 48.7 6.17sec 670491 649486 Direct 96.8 200315 450164 337049 54.7%  

Stats details: conflagrate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 48.67 96.83 0.00 0.00 1.0324 0.0000 32634742.27 32634742.27 0.00 649486.38 649486.38
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 43.84 45.28% 200314.66 131232 309309 200417.79 178276 225673 8781805 8781805 0.00
crit 52.99 54.72% 450164.28 262521 704887 450318.62 398031 509498 23852937 23852937 0.00
 
 

Action details: conflagrate

Static Values
  • id:17962
  • school:fire
  • resource:chi
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:9.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.roaring_blaze.enabled&(charges=2+set_bonus.tier19_4pc|(charges>=1+set_bonus.tier19_4pc&recharge_time<gcd)|target.time_to_die<24)
Spelldata
  • id:17962
  • name:Conflagrate
  • school:fire
  • tooltip:
  • description:Triggers an explosion on the target, dealing {$s1=1} Fire damage.{$?s196406=false}[ Reduces the cast time of Incinerate and Chaos Bolt by {$117828s1=30}% for {$117828d=10 seconds}.][] |cFFFFFFFFGenerates 1 Soul Shard.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.265510
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Deadly Grace 5227 0.5% 14.3 2.08sec 107763 0 Direct 14.3 94572 188936 107762 14.0%  

Stats details: deadly_grace

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.32 14.32 0.00 0.00 0.0000 0.0000 1542935.37 1542935.37 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 12.32 86.02% 94571.53 83888 100666 94579.34 87617 100666 1164762 1164762 0.00
crit 2.00 13.98% 188935.73 167777 201332 166147.67 0 201332 378173 378173 0.00
 
 

Action details: deadly_grace

Static Values
  • id:188091
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:25.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188091
  • name:Deadly Grace
  • school:arcane
  • tooltip:
  • description:Deal {$s1=63339 to 95008} Arcane damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:63338.72
  • base_dd_max:95008.08
 
Immolate 237781 22.9% 20.1 15.11sec 3553362 3398916 Direct 38.8 137793 275570 200956 45.8%  
Periodic 295.7 147474 294872 215244 46.0% 195.9%

Stats details: immolate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 20.11 38.82 295.67 295.67 1.0455 1.9956 71441807.07 71441807.07 0.00 116914.17 3398915.60
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 21.02 54.15% 137793.06 91047 214522 137772.93 115252 162722 2896871 2896871 0.00
crit 17.80 45.85% 275569.71 182099 429148 275515.12 224117 319952 4905087 4905087 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 159.7 54.02% 147474.25 77 510958 147687.57 124742 169962 23555763 23555763 0.00
crit 135.9 45.98% 294872.29 134 1033073 295320.35 252653 351711 40084086 40084086 0.00
 
 

Action details: immolate

Static Values
  • id:348
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:66000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.32
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:remains<=tick_time
Spelldata
  • id:348
  • name:Immolate
  • school:fire
  • tooltip:
  • description:Burns the enemy, causing {$s1=1} Fire damage immediately and an additional $157736o1 Fire damage over {$157736d=18 seconds}. |cFFFFFFFFPeriodic damage has a {$193541s1=15}% chance to generate 1 Soul Shard. Chance doubled on critical strikes.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.332000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.721500
  • base_td:0.00
  • dot_duration:18.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Incinerate 120550 11.6% 73.0 3.91sec 497102 406448 Direct 139.4 228289 456711 260266 14.0%  

Stats details: incinerate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 73.00 139.43 0.00 0.00 1.2230 0.0000 36288508.80 36288508.80 0.00 406448.21 406448.21
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 119.91 86.00% 228289.24 147176 346907 228340.25 214883 248709 27374284 27374284 0.00
crit 19.52 14.00% 456711.33 294380 693815 456837.31 384195 554802 8914225 8914225 0.00
 
 

Action details: incinerate

Static Values
  • id:29722
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:66000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:29722
  • name:Incinerate
  • school:fire
  • tooltip:
  • description:Draws fire toward the enemy, dealing {$s2=0} Fire damage.{$?s29722=true}|!c3[][ Replaces Shadow Bolt.]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.331000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Mark of the Hidden Satyr 8920 0.9% 20.1 14.91sec 133302 0 Direct 20.1 116904 233722 133299 14.0%  

Stats details: mark_of_the_hidden_satyr

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 20.12 20.12 0.00 0.00 0.0000 0.0000 2682469.99 2682469.99 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 17.30 85.96% 116903.77 111395 140616 116940.26 111395 128562 2022278 2022278 0.00
crit 2.82 14.04% 233722.02 222790 281233 220943.17 0 281233 660192 660192 0.00
 
 

Action details: mark_of_the_hidden_satyr

Static Values
  • id:191259
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191259
  • name:Mark of the Hidden Satyr
  • school:fire
  • tooltip:
  • description:Deals fire damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:2.500000
  • spell_power_mod.direct:2.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
pet - imp 42364 / 42364
Firebolt 42364 4.1% 109.5 2.75sec 116328 96207 Direct 108.6 102881 205809 117229 13.9%  

Stats details: firebolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 109.47 108.63 0.00 0.00 1.2092 0.0000 12734161.19 12734161.19 0.00 96207.08 96207.08
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 93.48 86.06% 102880.53 65724 124448 102908.07 100871 105042 9617608 9617608 0.00
crit 15.14 13.94% 205809.17 131449 248896 205872.08 182733 230972 3116553 3116553 0.00
 
 

Action details: firebolt

Static Values
  • id:3110
  • school:fire
  • resource:energy
  • range:40.0
  • travel_speed:16.0000
  • trigger_gcd:0.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.75
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:3110
  • name:Firebolt
  • school:fire
  • tooltip:
  • description:Deals {$s1=1} Fire damage to a target.$?a231795[ Damage increased by {$231795s1=50}% if you have Immolated the target.][] |cFF777777(Right-Click to toggle)|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
pet - service_imp 122618 / 39187
Firebolt 122618 3.8% 49.4 5.51sec 237771 209512 Direct 49.1 209869 419653 239169 14.0%  

Stats details: firebolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 49.39 49.10 0.00 0.00 1.1349 0.0000 11743779.30 11743779.30 0.00 209512.06 209512.06
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 42.24 86.03% 209868.82 131449 248896 210075.95 202175 217847 8865923 8865923 0.00
crit 6.86 13.97% 419652.98 262898 497791 419851.99 0 497791 2877857 2877857 0.00
 
 

Action details: firebolt

Static Values
  • id:3110
  • school:fire
  • resource:energy
  • range:40.0
  • travel_speed:16.0000
  • trigger_gcd:0.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.75
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:3110
  • name:Firebolt
  • school:fire
  • tooltip:
  • description:Deals {$s1=1} Fire damage to a target.$?a231795[ Damage increased by {$231795s1=50}% if you have Immolated the target.][] |cFF777777(Right-Click to toggle)|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
pet - infernal 116191 / 9838
Immolation 90529 0.7% 1.0 0.00sec 2263312 0 Periodic 46.8 42407 84846 48315 13.9% 8.1%

Stats details: immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 23.42 46.84 0.0000 1.0383 2263311.58 2263311.58 0.00 93071.45 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 40.3 86.08% 42406.65 36619 43943 42412.42 41379 43454 1709882 1709882 0.00
crit 6.5 13.92% 84845.90 73238 87885 84792.39 0 87885 553429 553429 0.00
 
 

Action details: immolation

Static Values
  • id:19483
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!ticking
Spelldata
  • id:19483
  • name:Immolation
  • school:fire
  • tooltip:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
 

Action details: immolation_tick

Static Values
  • id:20153
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all enemies near the caster.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
melee 25662 0.2% 22.2 1.10sec 28938 26485 Direct 22.2 25399 50819 28938 13.9%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.17 22.17 0.00 0.00 1.0927 0.0000 641587.93 943195.03 31.98 26484.54 26484.54
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 19.09 86.08% 25399.36 21898 26278 25399.88 24593 26278 484750 712628 31.98
crit 3.09 13.92% 50819.15 43796 52556 48825.76 0 52556 156838 230567 30.72
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
pet - doomguard 95916 / 8114
Doom Bolt 95916 0.8% 11.1 2.18sec 216605 101048 Direct 11.1 189992 379859 216628 14.0%  

Stats details: doom_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.07 11.07 0.00 0.00 2.1437 0.0000 2397972.18 2397972.18 0.00 101048.09 101048.09
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 9.52 85.98% 189992.31 183803 220564 190003.29 183803 220564 1808258 1808258 0.00
crit 1.55 14.02% 379859.36 367607 441128 311411.69 0 441128 589715 589715 0.00
 
 

Action details: doom_bolt

Static Values
  • id:85692
  • school:shadow
  • resource:energy
  • range:30.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:35.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:85692
  • name:Doom Bolt
  • school:shadow
  • tooltip:
  • description:Sends a shadowy bolt at the enemy, causing {$s1=1} Shadow damage. Deals {$s2=20}% additional damage to targets below 20% health.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
pet - lord_of_flames_infernal 116233 / 9843
Immolation 90546 0.7% 1.0 0.00sec 2263745 0 Periodic 46.8 42410 84804 48327 14.0% 8.1%

Stats details: immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 23.42 46.84 0.0000 1.0383 2263745.19 2263745.19 0.00 93089.28 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 40.3 86.05% 42410.07 36619 43943 42416.01 41339 43465 1709449 1709449 0.00
crit 6.5 13.95% 84803.69 73238 87885 84766.15 0 87885 554296 554296 0.00
 
 

Action details: immolation

Static Values
  • id:19483
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!ticking
Spelldata
  • id:19483
  • name:Immolation
  • school:fire
  • tooltip:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
 

Action details: immolation_tick

Static Values
  • id:20153
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all enemies near the caster.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
melee 25686 0.2% 22.2 1.10sec 28965 26509 Direct 22.2 25400 50815 28965 14.0%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.17 22.17 0.00 0.00 1.0927 0.0000 642187.56 944076.55 31.98 26509.29 26509.29
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 19.06 85.97% 25399.67 21898 26278 25400.29 24685 26278 484150 711747 31.98
crit 3.11 14.03% 50815.20 43796 52556 49064.70 0 52556 158037 232330 30.87
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
pet - lord_of_flames_infernal 116203 / 9841
Immolation 90542 0.7% 1.0 0.00sec 2263651 0 Periodic 46.8 42409 84823 48323 13.9% 8.1%

Stats details: immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 23.42 46.84 0.0000 1.0383 2263651.44 2263651.44 0.00 93085.43 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 40.3 86.05% 42408.51 36619 43943 42414.29 41339 43576 1709543 1709543 0.00
crit 6.5 13.95% 84822.89 73238 87885 84721.85 0 87885 554109 554109 0.00
 
 

Action details: immolation

Static Values
  • id:19483
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!ticking
Spelldata
  • id:19483
  • name:Immolation
  • school:fire
  • tooltip:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
 

Action details: immolation_tick

Static Values
  • id:20153
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all enemies near the caster.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
melee 25661 0.2% 22.2 1.10sec 28936 26483 Direct 22.2 25399 50820 28936 13.9%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.17 22.17 0.00 0.00 1.0927 0.0000 641538.87 943122.91 31.98 26482.51 26482.51
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 19.09 86.09% 25399.29 21898 26278 25400.03 24593 26278 484799 712700 31.98
crit 3.08 13.91% 50819.95 43796 52556 49019.21 0 52556 156740 230423 30.84
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
pet - lord_of_flames_infernal 116186 / 9837
Immolation 90531 0.7% 1.0 0.00sec 2263375 0 Periodic 46.8 42408 84823 48317 13.9% 8.1%

Stats details: immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 23.42 46.84 0.0000 1.0383 2263374.57 2263374.57 0.00 93074.04 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 40.3 86.07% 42408.46 36619 43943 42414.20 41217 43465 1709819 1709819 0.00
crit 6.5 13.93% 84823.48 73238 87885 84739.42 0 87885 553555 553555 0.00
 
 

Action details: immolation

Static Values
  • id:19483
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!ticking
Spelldata
  • id:19483
  • name:Immolation
  • school:fire
  • tooltip:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
 

Action details: immolation_tick

Static Values
  • id:20153
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all enemies near the caster.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
melee 25654 0.2% 22.2 1.10sec 28928 26476 Direct 22.2 25400 50811 28928 13.9%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.17 22.17 0.00 0.00 1.0927 0.0000 641379.44 942888.53 31.98 26475.93 26475.93
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 19.09 86.11% 25400.04 21898 26278 25400.58 24453 26278 484958 712935 31.98
crit 3.08 13.89% 50810.77 43796 52556 48867.48 0 52556 156421 229954 30.75
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
pet - shadowy_tear 121109 / 20323
Shadow Bolt 121109 1.9% 4.3 61.19sec 1412238 0 Periodic 47.7 111904 223847 127527 14.0% 19.5%

Stats details: shadow_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.30 0.00 47.94 47.67 0.0000 1.2218 6078857.91 6078857.91 0.00 103777.28 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 41.0 86.04% 111903.61 60 135209 111699.24 0 135209 4589737 4589737 0.00
crit 6.7 13.96% 223847.33 127 270419 220317.88 0 270419 1489120 1489120 0.00
 
 

Action details: shadow_bolt

Static Values
  • id:196657
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:196657
  • name:Shadow Bolt
  • school:shadow
  • tooltip:
  • description:Sends a shadowy bolt at the enemy, causing {$s1=1} Shadow damage.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:14.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
pet - chaos_tear 137949 / 9304
Chaos Bolt 137949 0.9% 4.3 60.39sec 653896 332131 Direct 4.2 0 658397 658397 100.0%  

Stats details: chaos_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.27 4.24 0.00 0.00 1.9689 0.0000 2789567.17 2789567.17 0.00 332130.87 332130.87
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 4.24 100.00% 658397.40 610226 770300 658861.26 0 770300 2789567 2789567 0.00
 
 

Action details: chaos_bolt

Static Values
  • id:215279
  • school:chromatic
  • resource:none
  • range:100.0
  • travel_speed:16.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:5.500
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:215279
  • name:Chaos Bolt
  • school:chromatic
  • tooltip:
  • description:Unleashes a devastating blast of chaos, causing {$s1=1} Chaos damage. Chaos Bolt always critically strikes and your critical strike chance increases its damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:5.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
pet - chaos_portal 250537 / 18568
Chaos Barrage 250537 1.8% 4.3 60.06sec 1280634 0 Periodic 153.2 31810 63612 36235 13.9% 7.8%

Stats details: chaos_barrage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.33 0.00 153.86 153.15 0.0000 0.1531 5549459.18 5549459.18 0.00 235575.80 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 131.8 86.09% 31810.22 131 37183 31749.59 0 37183 4193826 4193826 0.00
crit 21.3 13.91% 63611.76 265 74367 63478.02 0 74367 1355633 1355633 0.00
 
 

Action details: chaos_barrage

Static Values
  • id:187394
  • school:magic
  • resource:none
  • range:100.0
  • travel_speed:24.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:187394
  • name:Chaos Barrage
  • school:magic
  • tooltip:
  • description:Deals {$s1=1} Chaos damage.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:5.50
  • base_tick_time:0.25
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Simple Action Stats Execute Interval
Feretory
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Feretory
  • harmful:false
  • if_expr:
 
Berserking 2.1 180.68sec

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.07 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=15}%.
  • description:Increases your haste by {$s1=15}% for {$d=10 seconds}.
 
Dimensional Rift 12.8 23.93sec

Stats details: dimensional_rift

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.82 0.00 0.00 0.00 1.0046 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: dimensional_rift

Static Values
  • id:196586
  • school:none
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:45.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:charges=3
Spelldata
  • id:196586
  • name:Dimensional Rift
  • school:chaos
  • tooltip:
  • description:Rips a hole in time and space, opening a portal that damages your target.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Feretory
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Feretory
  • harmful:false
  • if_expr:
 
Havoc 14.9 20.87sec

Stats details: havoc

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.92 0.00 0.00 0.00 1.0619 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: havoc

Static Values
  • id:80240
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:88000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies>1&(active_enemies<4|talent.wreak_havoc.enabled&active_enemies<6)&!debuff.havoc.remains
Spelldata
  • id:80240
  • name:Havoc
  • school:shadow
  • tooltip:Spells cast by the Warlock also hit this target.
  • description:Marks a target with Havoc for {$d=8 seconds}, causing your single target spells to also strike the Havoc victim. Limit 1.
 
Life Tap 6.2 34.96sec

Stats details: life_tap

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.20 0.00 0.00 0.00 1.0383 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: life_tap

Static Values
  • id:1454
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.empowered_life_tap.enabled&!buff.empowered_life_tap.remains
Spelldata
  • id:1454
  • name:Life Tap
  • school:shadow
  • tooltip:
  • description:Restores {$s1=30}% of your maximum mana, at the cost of {$s2=10}% of your maximum health.
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Grimoire: Imp (service_imp) 3.7 91.64sec

Stats details: service_imp

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.69 0.00 0.00 0.00 0.9663 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: service_imp

Static Values
  • id:111859
  • school:shadow
  • resource:soul_shard
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:90.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:111859
  • name:Grimoire: Imp
  • school:shadow
  • tooltip:
  • description:Summons an Imp who attacks the target for {$108501s1=25} sec. Imps cast ranged Firebolts and cleanse a hostile magic effect from their master.
 
Soul Harvest 2.9 120.82sec

Stats details: soul_harvest

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.91 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: soul_harvest

Static Values
  • id:196098
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:196098
  • name:Soul Harvest
  • school:shadow
  • tooltip:Damage increased by {$s1=20}%.
  • description:Increases your damage and your pets' damage by {$s1=20}%. Lasts {$d=15 seconds}, increased by {$s2=2} sec for each target afflicted by your {$?s137043=false}[Agony][]{$?s137044=false}[Doom][]{$?s137046=false}[Immolate][], up to a maximum of {$s3=35} sec.
 
Summon Doomguard 1.0 0.00sec

Stats details: summon_doomguard

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 1.0737 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_doomguard

Static Values
  • id:18540
  • school:shadow
  • resource:soul_shard
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.grimoire_of_supremacy.enabled&active_enemies=1&artifact.lord_of_flames.rank=0
Spelldata
  • id:18540
  • name:Summon Doomguard
  • school:shadow
  • tooltip:
  • description:Summons a Doomguard for {$60478d=25 seconds} to assault the target with its Doom Bolts.
 
Summon Imp 1.0 0.00sec

Stats details: summon_imp

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_imp

Static Values
  • id:688
  • school:shadow
  • resource:soul_shard
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!talent.grimoire_of_supremacy.enabled&(!talent.grimoire_of_sacrifice.enabled|buff.demonic_power.down)
Spelldata
  • id:688
  • name:Summon Imp
  • school:shadow
  • tooltip:
  • description:Summons an Imp under your command that casts ranged Firebolts.$?s74434[ |cFFFFFFFFSoulburn:|r |cFF8282FFInstant cast.|r][]
 
Summon Infernal 1.0 0.00sec

Stats details: summon_infernal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.7563 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_infernal

Static Values
  • id:1122
  • school:shadow
  • resource:soul_shard
  • range:30.0
  • travel_speed:1.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.grimoire_of_supremacy.enabled&artifact.lord_of_flames.rank>0
Spelldata
  • id:1122
  • name:Summon Infernal
  • school:shadow
  • tooltip:
  • description:Summons an Infernal from the Twisting Nether, impacting for {$22703s1=0} Fire damage and stunning all enemy targets in the area for {$22703d=2 seconds}. The Infernal will serve you for {$111685d=25 seconds}, dealing strong area-of-effect damage.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Accelerando 20.1 0.0 15.4sec 15.4sec 78.54% 78.54% 1.4(1.4) 19.3

Buff details

  • buff initial source:Feretory
  • cooldown name:buff_accelerando
  • max_stacks:5
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:734.41

Stack Uptimes

  • accelerando_1:29.89%
  • accelerando_2:24.57%
  • accelerando_3:14.63%
  • accelerando_4:6.55%
  • accelerando_5:2.90%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225719
  • name:Accelerando
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc225125=Your damaging spells have a chance to grant you {$225719s1=528} Haste for {$225719d=12 seconds}, stacking up to 5 times. Stacking does not refresh duration.}
  • max_stacks:5
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Berserking 2.1 0.0 180.7sec 180.7sec 6.87% 8.50% 0.0(0.0) 2.0

Buff details

  • buff initial source:Feretory
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:10.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • berserking_1:6.87%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=15}%.
  • description:Increases your haste by {$s1=15}% for {$d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.55% 15.52% 0.0(0.0) 1.0

Buff details

  • buff initial source:Feretory
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:13.55%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Conflagration of Chaos 24.4 0.0 12.2sec 12.2sec 49.38% 47.44% 0.0(0.0) 0.8

Buff details

  • buff initial source:Feretory
  • cooldown name:buff_conflagration_of_chaos
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:50.00%
  • default_value:-0.00

Stack Uptimes

  • conflagration_of_chaos_1:49.38%

Trigger Attempt Success

  • trigger_pct:50.13%

Spelldata details

  • id:196546
  • name:Conflagration of Chaos
  • tooltip:Your {$?s17877=false}[Shadowburn][Conflagrate] will always critically strike. Critical strike chance will increase the critical strike damage of {$?s17877=false}[Shadowburn][Conflagrate].
  • description:{$@spelldesc219195={$?s17877=false}[Shadowburn][Conflagrate] has a chance to guarantee your next {$?s17877=false}[Shadowburn][Conflagrate] critically strikes, and to increase its damage by your critical strike chance.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Devil's Due 3.5 0.0 69.3sec 69.3sec 8.75% 10.29% 0.0(0.0) 3.2

Buff details

  • buff initial source:Feretory
  • cooldown name:buff_devils_due
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.18

Stack Uptimes

  • devils_due_1:8.75%

Trigger Attempt Success

  • trigger_pct:99.91%

Spelldata details

  • id:225776
  • name:Devil's Due
  • tooltip:Cast speed slowed by {$s1=7}%.
  • description:{$@spelldesc225142=Your damaging spells have a chance to grant Nefarious Pact, increasing your casting speed by {$225774s1=17}% for {$225774d=12 seconds}. When Nefarious Pact expires, your casting speed is decreased by {$225776s1=7}% for {$225776d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Embrace Chaos 25.6 44.1 12.0sec 4.3sec 66.14% 74.53% 44.1(44.1) 24.9

Buff details

  • buff initial source:Feretory
  • cooldown name:buff_embrace_chaos
  • max_stacks:1
  • duration:4.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • embrace_chaos_1:66.14%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:212019
  • name:Embrace Chaos
  • tooltip:Chaos Bolt has {$s1=40}% reduced cast time.
  • description:{$@spelldesc212018=Casting Chaos Bolt reduces the cast time of your next Chaos Bolt by {$212019s1=40}% for {$212019d=4 seconds}.}
  • max_stacks:0
  • duration:4.00
  • cooldown:0.00
  • default_chance:0.00%
Lord of Flames 1.0 0.0 0.0sec 0.0sec 97.98% 97.98% 0.0(0.0) 0.0

Buff details

  • buff initial source:Feretory
  • cooldown name:buff_lord_of_flames
  • max_stacks:1
  • duration:600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • lord_of_flames_1:97.98%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:226802
  • name:Lord of Flames
  • tooltip:Recently activated Lord of Flames.
  • description:{$@spelldesc224103=Once every {$s2=10} minutes, {$?s152107=false}[your Infernal's Meteor Strike][Summon Infernal] will summon {$s3=3} additional Infernals to serve you for {$226804d=25 seconds}.}
  • max_stacks:0
  • duration:600.00
  • cooldown:0.00
  • default_chance:0.00%
Nefarious Pact 3.5 0.0 69.7sec 68.9sec 13.62% 15.12% 0.0(0.0) 3.3

Buff details

  • buff initial source:Feretory
  • cooldown name:buff_nefarious_pact
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.44

Stack Uptimes

  • nefarious_pact_1:13.62%

Trigger Attempt Success

  • trigger_pct:99.91%

Spelldata details

  • id:225774
  • name:Nefarious Pact
  • tooltip:Cast speed increased by {$s1=17}%.
  • description:{$@spelldesc225142=Your damaging spells have a chance to grant Nefarious Pact, increasing your casting speed by {$225774s1=17}% for {$225774d=12 seconds}. When Nefarious Pact expires, your casting speed is decreased by {$225776s1=7}% for {$225776d=8 seconds}.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of Deadly Grace 1.0 0.0 0.0sec 0.0sec 10.16% 10.16% 0.0(0.0) 1.0

Buff details

  • buff initial source:Feretory
  • cooldown name:buff_potion_of_deadly_grace
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_deadly_grace_1:10.16%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188027
  • name:Potion of Deadly Grace
  • tooltip:Your attacks have a chance to unleash a bolt of energy at your target.
  • description:Grants your attacks a chance to unleash a bolt of energy at your target. Staying away from enemies for the entire duration of the effect will extend the effect by an additional 5 seconds.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
Potion of Prolonged Power 1.0 0.0 0.0sec 0.0sec 19.64% 19.64% 0.0(0.0) 1.0

Buff details

  • buff initial source:Feretory
  • cooldown name:buff_potion_of_prolonged_power
  • max_stacks:1
  • duration:60.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:all
  • amount:2500.00

Stack Uptimes

  • potion_of_prolonged_power_1:19.64%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:229206
  • name:Potion of Prolonged Power
  • tooltip:All stats increased by {$s1=2500}.
  • description:Drink to increase all stats by {$s1=2500} for {$d=60 seconds}.
  • max_stacks:0
  • duration:60.00
  • cooldown:1.00
  • default_chance:0.00%
Soul Harvest 2.9 0.0 120.8sec 120.8sec 17.79% 17.79% 0.0(0.0) 2.7

Buff details

  • buff initial source:Feretory
  • cooldown name:buff_soul_harvest
  • max_stacks:1
  • duration:15.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • soul_harvest_1:17.79%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:196098
  • name:Soul Harvest
  • tooltip:Damage increased by {$s1=20}%.
  • description:Increases your damage and your pets' damage by {$s1=20}%. Lasts {$d=15 seconds}, increased by {$s2=2} sec for each target afflicted by your {$?s137043=false}[Agony][]{$?s137044=false}[Doom][]{$?s137046=false}[Immolate][], up to a maximum of {$s3=35} sec.
  • max_stacks:0
  • duration:15.00
  • cooldown:120.00
  • default_chance:0.00%
Constant Buffs
Well Fed (azshari_salad)

Buff details

  • buff initial source:Feretory
  • cooldown name:buff_azshari_salad
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:375.00

Stack Uptimes

  • azshari_salad_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225603
  • name:Well Fed
  • tooltip:Haste increased by $w1.
  • description:Increases haste by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Defiled Augmentation

Buff details

  • buff initial source:Feretory
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Whispered Pact

Buff details

  • buff initial source:Feretory
  • cooldown name:buff_flask_of_the_whispered_pact
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:1300.00

Stack Uptimes

  • flask_of_the_whispered_pact_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188031
  • name:Flask of the Whispered Pact
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%

Procs

Count Interval
shadowy_tear 4.3 60.3sec
chaos_tear 4.3 60.7sec
chaos_portal 4.3 59.9sec
dimension_ripper 3.7 57.2sec

Resources

Resource Usage Type Count Total Average RPE APR
Feretory
chaos_bolt Soul Shard 69.6 139.3 2.0 2.0 825076.0
havoc Mana 14.9 1312610.2 88000.0 88000.2 0.0
immolate Mana 20.1 1326927.9 66000.0 65998.5 53.8
incinerate Mana 73.0 4818013.2 66000.0 66000.1 7.5
service_imp Soul Shard 3.7 3.7 1.0 1.0 0.0
summon_doomguard Soul Shard 1.0 1.0 1.0 1.0 0.0
summon_infernal Soul Shard 1.0 1.0 1.0 1.0 0.0
pet - imp
firebolt Energy 109.5 4378.7 40.0 40.0 2908.2
pet - service_imp
firebolt Energy 49.4 1975.7 40.0 40.0 5944.1
pet - doomguard
doom_bolt Energy 11.1 387.5 35.0 35.0 6188.8
Resource Gains Type Count Total Average Overflow
life_tap Mana 6.20 2045683.30 (31.02%) 330000.00 0.00 0.00%
immolate Soul Shard 64.71 63.67 (44.29%) 0.98 1.04 1.60%
conflagrate Soul Shard 48.67 48.56 (33.78%) 1.00 0.11 0.23%
mp5_regen Mana 482.53 4549182.38 (68.98%) 9427.70 110346.38 2.37%
soulsnatcher Soul Shard 10.43 10.43 (7.26%) 1.00 0.00 0.00%
feretory_of_souls Soul Shard 21.16 21.10 (14.68%) 1.00 0.05 0.26%
pet - imp
energy_regen Energy 1903.55 4212.27 (100.00%) 2.21 21.55 0.51%
pet - service_imp
energy_regen Energy 447.32 1359.31 (100.00%) 3.04 61.96 4.36%
pet - doomguard
energy_regen Energy 15.89 346.62 (100.00%) 21.81 42.91 11.02%
Resource RPS-Gain RPS-Loss
Health 0.00 6540.03
Mana 21900.96 24765.94
Soul Shard 0.48 0.48
Combat End Resource Mean Min Max
Mana 236212.00 13196.68 541425.08
Soul Shard 1.82 0.00 5.00

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 1.7%

Statistics & Data Analysis

Fight Length
Sample Data Feretory Fight Length
Count 9999
Mean 301.12
Minimum 221.26
Maximum 379.15
Spread ( max - min ) 157.89
Range [ ( max - min ) / 2 * 100% ] 26.22%
DPS
Sample Data Feretory Damage Per Second
Count 9999
Mean 1040044.55
Minimum 915496.05
Maximum 1210359.20
Spread ( max - min ) 294863.15
Range [ ( max - min ) / 2 * 100% ] 14.18%
Priority Target DPS
Sample Data Feretory Priority Target Damage Per Second
Count 9999
Mean 604965.39
Minimum 538346.64
Maximum 695303.09
Spread ( max - min ) 156956.45
Range [ ( max - min ) / 2 * 100% ] 12.97%
DPS(e)
Sample Data Feretory Damage Per Second (Effective)
Count 9999
Mean 1040044.55
Minimum 915496.05
Maximum 1210359.20
Spread ( max - min ) 294863.15
Range [ ( max - min ) / 2 * 100% ] 14.18%
Damage
Sample Data Feretory Damage
Count 9999
Mean 259497161.43
Minimum 184495953.37
Maximum 344696985.26
Spread ( max - min ) 160201031.89
Range [ ( max - min ) / 2 * 100% ] 30.87%
DTPS
Sample Data Feretory Damage Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Feretory Healing Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS(e)
Sample Data Feretory Healing Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Feretory Heal
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Feretory Healing Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Feretory Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
ETMI
Sample Data FeretoryTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data Feretory Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=whispered_pact
1 0.00 food,type=azshari_salad
2 0.00 summon_pet,if=!talent.grimoire_of_supremacy.enabled&(!talent.grimoire_of_sacrifice.enabled|buff.demonic_power.down)
3 0.00 summon_infernal,if=talent.grimoire_of_supremacy.enabled&artifact.lord_of_flames.rank>0
4 0.00 summon_infernal,if=talent.grimoire_of_supremacy.enabled&active_enemies>1
5 0.00 summon_doomguard,if=talent.grimoire_of_supremacy.enabled&active_enemies=1&artifact.lord_of_flames.rank=0
6 0.00 augmentation,type=defiled
7 0.00 snapshot_stats
8 0.00 grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
9 0.00 life_tap,if=talent.empowered_life_tap.enabled&!buff.empowered_life_tap.remains
A 0.00 potion,name=prolonged_power
B 0.00 chaos_bolt
Default action list Executed every time the actor is available.
# count action,conditions
C 14.92 havoc,target=2,if=active_enemies>1&(active_enemies<4|talent.wreak_havoc.enabled&active_enemies<6)&!debuff.havoc.remains
D 1.00 dimensional_rift,if=charges=3
E 10.35 immolate,if=remains<=tick_time
F 0.68 immolate,cycle_targets=1,if=active_enemies>1&remains<=tick_time&(!talent.roaring_blaze.enabled|(!debuff.roaring_blaze.remains&action.conflagrate.charges<2))
G 9.11 immolate,if=talent.roaring_blaze.enabled&remains<=duration&!debuff.roaring_blaze.remains&target.time_to_die>10&(action.conflagrate.charges=2+set_bonus.tier19_4pc|(action.conflagrate.charges>=1+set_bonus.tier19_4pc&action.conflagrate.recharge_time<cast_time+gcd)|target.time_to_die<24)
H 2.08 berserking
0.00 blood_fury
0.00 arcane_torrent
I 1.00 potion,name=deadly_grace,if=(buff.soul_harvest.remains|trinket.proc.any.react|target.time_to_die<=45)
0.00 shadowburn,if=buff.conflagration_of_chaos.remains<=action.chaos_bolt.cast_time
0.00 shadowburn,if=(charges=1&recharge_time<action.chaos_bolt.cast_time|charges=2)&soul_shard<5
J 14.13 conflagrate,if=talent.roaring_blaze.enabled&(charges=2+set_bonus.tier19_4pc|(charges>=1+set_bonus.tier19_4pc&recharge_time<gcd)|target.time_to_die<24)
K 34.55 conflagrate,if=talent.roaring_blaze.enabled&debuff.roaring_blaze.stack>0&dot.immolate.remains>dot.immolate.duration*0.3&(active_enemies=1|soul_shard<3)&soul_shard<5
0.00 conflagrate,if=!talent.roaring_blaze.enabled&!buff.backdraft.remains&buff.conflagration_of_chaos.remains<=action.chaos_bolt.cast_time
0.00 conflagrate,if=!talent.roaring_blaze.enabled&!buff.backdraft.remains&(charges=1&recharge_time<action.chaos_bolt.cast_time|charges=2)&soul_shard<5
0.00 life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<=gcd
0.00 dimensional_rift,if=equipped.144369&!buff.lessons_of_spacetime.remains&((!talent.grimoire_of_supremacy.enabled&!cooldown.summon_doomguard.remains)|(talent.grimoire_of_service.enabled&!cooldown.service_pet.remains)|(talent.soul_harvest.enabled&!cooldown.soul_harvest.remains))
L 3.69 service_pet
M 1.00 summon_infernal,if=artifact.lord_of_flames.rank>0&!buff.lord_of_flames.remains
N 1.00 summon_doomguard,if=!talent.grimoire_of_supremacy.enabled&spell_targets.infernal_awakening<=2&(target.time_to_die>180|target.health.pct<=20|target.time_to_die<30)
0.00 summon_infernal,if=!talent.grimoire_of_supremacy.enabled&spell_targets.infernal_awakening>2
0.00 summon_doomguard,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal=1&artifact.lord_of_flames.rank>0&buff.lord_of_flames.remains&!pet.doomguard.active
0.00 summon_doomguard,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal=1&equipped.132379&!cooldown.sindorei_spite_icd.remains
0.00 summon_infernal,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal>1&equipped.132379&!cooldown.sindorei_spite_icd.remains
O 2.91 soul_harvest
0.00 channel_demonfire,if=dot.immolate.remains>cast_time
0.00 havoc,if=active_enemies=1&talent.wreak_havoc.enabled&equipped.132375&!debuff.havoc.remains
0.00 rain_of_fire,if=active_enemies>=3&cooldown.havoc.remains<=12&!talent.wreak_havoc.enabled
0.00 rain_of_fire,if=active_enemies>=6&talent.wreak_havoc.enabled
P 11.82 dimensional_rift,if=!equipped.144369|charges>1|((!talent.grimoire_of_service.enabled|recharge_time<cooldown.service_pet.remains)&(!talent.soul_harvest.enabled|recharge_time<cooldown.soul_harvest.remains)&(!talent.grimoire_of_supremacy.enabled|recharge_time<cooldown.summon_doomguard.remains))
0.00 life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<duration*0.3
0.00 cataclysm
Q 68.98 chaos_bolt,if=(cooldown.havoc.remains>12&cooldown.havoc.remains|active_enemies<3|talent.wreak_havoc.enabled&active_enemies<6)
0.00 shadowburn
0.00 conflagrate,if=!talent.roaring_blaze.enabled&!buff.backdraft.remains
0.00 immolate,if=!talent.roaring_blaze.enabled&remains<=duration*0.3
R 73.32 incinerate
S 6.20 life_tap

Sample Sequence

0126ABCDEGHJKLMKOPPQKQQRKQRQKRRCQQQERQQRRGJQKQKQKQQCRRKQPRRQREQRQRRCGJQKQKQKQRQKQRRCRQERRPQLGJKQKCQQKQRRRRKQQRRREPQCSOIRRGJKQQKPQQQKQCKQRQQERQRRRRQGCJKQQFQKQKQQKPHQRCLERRSRRRGJQKQKQKCRQRKQQRREQQRRSPCRRGJNKQQKKQRRRKCOQRRESRQRRRRQGJKKQCRSPKQLQJQRQRJERCQJQRRRJQ

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask Feretory 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 1 food Feretory 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 2 summon_imp Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 6 augmentation Feretory 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat A potion Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard potion_of_prolonged_power
0:00.000 precombat B chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard embrace_chaos, nefarious_pact, accelerando, potion_of_prolonged_power
0:00.000 default C havoc enemy2 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard embrace_chaos, nefarious_pact, accelerando, potion_of_prolonged_power
0:00.788 default D dimensional_rift Fluffy_Pillow 1023482.2/1100000: 93% mana | 1.0/5: 20% soul_shard embrace_chaos, nefarious_pact, accelerando, potion_of_prolonged_power
0:01.577 default E immolate Fluffy_Pillow 1038428.0/1100000: 94% mana | 1.0/5: 20% soul_shard bloodlust, embrace_chaos, nefarious_pact, accelerando, potion_of_prolonged_power
0:02.331 default G immolate Fluffy_Pillow 986753.2/1100000: 90% mana | 1.0/5: 20% soul_shard bloodlust, embrace_chaos, nefarious_pact, accelerando(2), potion_of_prolonged_power
0:03.084 default H berserking Fluffy_Pillow 935228.1/1100000: 85% mana | 1.0/5: 20% soul_shard bloodlust, embrace_chaos, nefarious_pact, accelerando(2), potion_of_prolonged_power
0:03.084 default J conflagrate Fluffy_Pillow 935228.1/1100000: 85% mana | 1.0/5: 20% soul_shard bloodlust, berserking, embrace_chaos, nefarious_pact, accelerando(2), potion_of_prolonged_power
0:03.839 default K conflagrate Fluffy_Pillow 951918.5/1100000: 87% mana | 2.0/5: 40% soul_shard bloodlust, berserking, embrace_chaos, nefarious_pact, accelerando(2), potion_of_prolonged_power
0:04.596 default L service_imp Fluffy_Pillow 968653.1/1100000: 88% mana | 4.0/5: 80% soul_shard bloodlust, berserking, nefarious_pact, accelerando(2), potion_of_prolonged_power
0:05.352 default M summon_infernal Fluffy_Pillow 985365.6/1100000: 90% mana | 3.0/5: 60% soul_shard bloodlust, berserking, nefarious_pact, accelerando(2), potion_of_prolonged_power
0:06.106 default K conflagrate Fluffy_Pillow 1002033.8/1100000: 91% mana | 2.0/5: 40% soul_shard bloodlust, berserking, lord_of_flames, nefarious_pact, accelerando(2), potion_of_prolonged_power
0:06.861 default O soul_harvest Fluffy_Pillow 1018724.2/1100000: 93% mana | 4.0/5: 80% soul_shard bloodlust, berserking, lord_of_flames, nefarious_pact, accelerando(2), potion_of_prolonged_power
0:06.861 default P dimensional_rift Fluffy_Pillow 1018724.2/1100000: 93% mana | 4.0/5: 80% soul_shard bloodlust, berserking, soul_harvest, lord_of_flames, nefarious_pact, accelerando(2), potion_of_prolonged_power
0:07.616 default P dimensional_rift Fluffy_Pillow 1035414.6/1100000: 94% mana | 4.0/5: 80% soul_shard bloodlust, berserking, soul_harvest, lord_of_flames, nefarious_pact, accelerando(2), potion_of_prolonged_power
0:08.371 default Q chaos_bolt Fluffy_Pillow 1052105.0/1100000: 96% mana | 4.0/5: 80% soul_shard bloodlust, berserking, soul_harvest, lord_of_flames, nefarious_pact, accelerando(2), potion_of_prolonged_power
0:09.409 default K conflagrate Fluffy_Pillow 1075325.7/1100000: 98% mana | 2.0/5: 40% soul_shard bloodlust, berserking, soul_harvest, lord_of_flames, embrace_chaos, nefarious_pact, accelerando(3), potion_of_prolonged_power
0:10.163 default Q chaos_bolt Fluffy_Pillow 1092425.9/1100000: 99% mana | 5.0/5: 100% soul_shard bloodlust, berserking, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(4), potion_of_prolonged_power
0:10.916 default Q chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard bloodlust, berserking, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(4), potion_of_prolonged_power
0:11.670 default R incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard bloodlust, berserking, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(5), potion_of_prolonged_power
0:12.425 default K conflagrate Fluffy_Pillow 1037455.4/1100000: 94% mana | 1.0/5: 20% soul_shard bloodlust, berserking, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due, potion_of_prolonged_power
0:13.333 default Q chaos_bolt Fluffy_Pillow 1056246.1/1100000: 96% mana | 2.0/5: 40% soul_shard bloodlust, soul_harvest, lord_of_flames, embrace_chaos, devils_due, potion_of_prolonged_power
0:14.587 default R incinerate Fluffy_Pillow 1079649.3/1100000: 98% mana | 1.0/5: 20% soul_shard bloodlust, soul_harvest, lord_of_flames, embrace_chaos, devils_due, potion_of_prolonged_power
0:15.840 default Q chaos_bolt Fluffy_Pillow 1034056.0/1100000: 94% mana | 2.0/5: 40% soul_shard bloodlust, soul_harvest, lord_of_flames, embrace_chaos, devils_due, potion_of_prolonged_power
0:17.093 default K conflagrate Fluffy_Pillow 1057440.5/1100000: 96% mana | 0.0/5: 0% soul_shard bloodlust, soul_harvest, lord_of_flames, embrace_chaos, devils_due, potion_of_prolonged_power
0:18.138 default R incinerate Fluffy_Pillow 1076943.2/1100000: 98% mana | 1.0/5: 20% soul_shard bloodlust, soul_harvest, lord_of_flames, embrace_chaos, devils_due, potion_of_prolonged_power
0:19.394 default R incinerate Fluffy_Pillow 1034113.7/1100000: 94% mana | 1.0/5: 20% soul_shard bloodlust, soul_harvest, lord_of_flames, embrace_chaos, devils_due, accelerando, potion_of_prolonged_power
0:20.630 default C havoc enemy2 991530.2/1100000: 90% mana | 1.0/5: 20% soul_shard bloodlust, soul_harvest, lord_of_flames, embrace_chaos, accelerando(2), potion_of_prolonged_power
0:21.494 default Q chaos_bolt Fluffy_Pillow 920138.9/1100000: 84% mana | 2.0/5: 40% soul_shard bloodlust, soul_harvest, lord_of_flames, accelerando(2), potion_of_prolonged_power
0:23.215 default Q chaos_bolt Fluffy_Pillow 953461.0/1100000: 87% mana | 3.0/5: 60% soul_shard bloodlust, soul_harvest, lord_of_flames, embrace_chaos, accelerando(3), potion_of_prolonged_power
0:24.234 default Q chaos_bolt Fluffy_Pillow 973334.5/1100000: 88% mana | 2.0/5: 40% soul_shard bloodlust, soul_harvest, lord_of_flames, embrace_chaos, accelerando(3), potion_of_prolonged_power
0:25.253 default E immolate Fluffy_Pillow 993208.0/1100000: 90% mana | 0.0/5: 0% soul_shard bloodlust, soul_harvest, lord_of_flames, embrace_chaos, accelerando(3), potion_of_prolonged_power
0:26.103 default R incinerate Fluffy_Pillow 943785.5/1100000: 86% mana | 0.0/5: 0% soul_shard bloodlust, lord_of_flames, embrace_chaos, accelerando(3), potion_of_prolonged_power
0:27.121 default Q chaos_bolt Fluffy_Pillow 897639.4/1100000: 82% mana | 2.0/5: 40% soul_shard bloodlust, lord_of_flames, embrace_chaos, accelerando(3), potion_of_prolonged_power
0:28.139 default Q chaos_bolt Fluffy_Pillow 917493.4/1100000: 83% mana | 2.0/5: 40% soul_shard bloodlust, lord_of_flames, embrace_chaos, accelerando(3), potion_of_prolonged_power
0:29.157 default R incinerate Fluffy_Pillow 937347.3/1100000: 85% mana | 0.0/5: 0% soul_shard bloodlust, lord_of_flames, embrace_chaos, accelerando(3), potion_of_prolonged_power
0:30.177 default R incinerate Fluffy_Pillow 891240.3/1100000: 81% mana | 1.0/5: 20% soul_shard bloodlust, lord_of_flames, embrace_chaos, accelerando(3), potion_of_prolonged_power
0:31.196 default G immolate Fluffy_Pillow 844584.5/1100000: 77% mana | 1.0/5: 20% soul_shard bloodlust, lord_of_flames, embrace_chaos, potion_of_prolonged_power
0:32.084 default J conflagrate Fluffy_Pillow 795157.1/1100000: 72% mana | 2.0/5: 40% soul_shard bloodlust, lord_of_flames, embrace_chaos, potion_of_prolonged_power
0:32.972 default Q chaos_bolt Fluffy_Pillow 811729.7/1100000: 74% mana | 3.0/5: 60% soul_shard bloodlust, lord_of_flames, conflagration_of_chaos, embrace_chaos, potion_of_prolonged_power
0:34.038 default K conflagrate Fluffy_Pillow 831869.2/1100000: 76% mana | 2.0/5: 40% soul_shard bloodlust, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2), potion_of_prolonged_power
0:34.901 default Q chaos_bolt Fluffy_Pillow 848458.7/1100000: 77% mana | 3.0/5: 60% soul_shard bloodlust, lord_of_flames, embrace_chaos, accelerando(2), potion_of_prolonged_power
0:35.936 default K conflagrate Fluffy_Pillow 868354.5/1100000: 79% mana | 1.0/5: 20% soul_shard bloodlust, lord_of_flames, embrace_chaos, accelerando(2), potion_of_prolonged_power
0:36.797 default Q chaos_bolt Fluffy_Pillow 884905.5/1100000: 80% mana | 3.0/5: 60% soul_shard bloodlust, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2), potion_of_prolonged_power
0:37.831 default K conflagrate Fluffy_Pillow 904782.1/1100000: 82% mana | 1.0/5: 20% soul_shard bloodlust, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2), potion_of_prolonged_power
0:38.692 default Q chaos_bolt Fluffy_Pillow 921333.1/1100000: 84% mana | 4.0/5: 80% soul_shard bloodlust, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2), potion_of_prolonged_power
0:39.727 default Q chaos_bolt Fluffy_Pillow 941230.6/1100000: 86% mana | 3.0/5: 60% soul_shard bloodlust, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3), potion_of_prolonged_power
0:40.746 default C havoc enemy2 961104.1/1100000: 87% mana | 1.0/5: 20% soul_shard bloodlust, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3), potion_of_prolonged_power
0:41.597 default R incinerate Fluffy_Pillow 885871.0/1100000: 81% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3), potion_of_prolonged_power
0:42.919 default R incinerate Fluffy_Pillow 839955.8/1100000: 76% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(4), potion_of_prolonged_power
0:44.224 default K conflagrate Fluffy_Pillow 793815.1/1100000: 72% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(4), potion_of_prolonged_power
0:45.312 default Q chaos_bolt Fluffy_Pillow 810248.8/1100000: 74% mana | 3.0/5: 60% soul_shard lord_of_flames, potion_of_prolonged_power
0:47.616 default P dimensional_rift Fluffy_Pillow 843648.7/1100000: 77% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando, potion_of_prolonged_power
0:48.753 default R incinerate Fluffy_Pillow 860216.3/1100000: 78% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando, potion_of_prolonged_power
0:50.114 default R incinerate Fluffy_Pillow 814047.9/1100000: 74% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando, potion_of_prolonged_power
0:51.477 default Q chaos_bolt Fluffy_Pillow 767908.6/1100000: 70% mana | 3.0/5: 60% soul_shard lord_of_flames, embrace_chaos, accelerando, potion_of_prolonged_power
0:52.840 default R incinerate Fluffy_Pillow 787769.4/1100000: 72% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando, potion_of_prolonged_power
0:54.203 default E immolate Fluffy_Pillow 741631.2/1100000: 67% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando(2), potion_of_prolonged_power
0:55.322 default Q chaos_bolt Fluffy_Pillow 692177.8/1100000: 63% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando(2), potion_of_prolonged_power
0:56.665 default R incinerate Fluffy_Pillow 712036.6/1100000: 65% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando(2), potion_of_prolonged_power
0:58.008 default Q chaos_bolt Fluffy_Pillow 665895.5/1100000: 61% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando(2)
0:59.351 default R incinerate Fluffy_Pillow 685221.9/1100000: 62% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos, accelerando
1:00.714 default R incinerate Fluffy_Pillow 639082.6/1100000: 58% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando
1:02.077 default C havoc enemy2 592944.5/1100000: 54% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando(2)
1:03.197 default G immolate Fluffy_Pillow 521505.8/1100000: 47% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando(2)
1:04.315 default J conflagrate Fluffy_Pillow 472037.6/1100000: 43% mana | 2.0/5: 40% soul_shard lord_of_flames, accelerando(2)
1:05.434 default Q chaos_bolt Fluffy_Pillow 488584.2/1100000: 44% mana | 3.0/5: 60% soul_shard lord_of_flames, accelerando(2)
1:07.669 default K conflagrate Fluffy_Pillow 521848.5/1100000: 47% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando(3)
1:08.774 default Q chaos_bolt Fluffy_Pillow 538426.0/1100000: 49% mana | 3.0/5: 60% soul_shard lord_of_flames, embrace_chaos, accelerando(3)
1:10.098 default K conflagrate Fluffy_Pillow 558288.9/1100000: 51% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando(3)
1:11.202 default Q chaos_bolt Fluffy_Pillow 574851.4/1100000: 52% mana | 3.0/5: 60% soul_shard lord_of_flames, embrace_chaos, accelerando(3)
1:12.525 default K conflagrate Fluffy_Pillow 593937.5/1100000: 54% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos
1:13.680 default Q chaos_bolt Fluffy_Pillow 610608.1/1100000: 56% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando
1:15.044 default R incinerate Fluffy_Pillow 630483.4/1100000: 57% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando
1:16.409 default Q chaos_bolt Fluffy_Pillow 584373.2/1100000: 53% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando
1:17.772 default K conflagrate Fluffy_Pillow 604234.0/1100000: 55% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando
1:18.908 default Q chaos_bolt Fluffy_Pillow 620787.0/1100000: 56% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
1:20.271 default R incinerate Fluffy_Pillow 640647.7/1100000: 58% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
1:21.634 default R incinerate Fluffy_Pillow 594509.5/1100000: 54% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
1:22.977 default C havoc enemy2 548368.4/1100000: 50% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
1:24.097 default R incinerate Fluffy_Pillow 476929.7/1100000: 43% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
1:25.441 default Q chaos_bolt Fluffy_Pillow 430874.2/1100000: 39% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos
1:27.743 default E immolate Fluffy_Pillow 463921.7/1100000: 42% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
1:28.898 default R incinerate Fluffy_Pillow 414502.9/1100000: 38% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
1:30.280 default R incinerate Fluffy_Pillow 368343.0/1100000: 33% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
1:31.663 default P dimensional_rift Fluffy_Pillow 322197.4/1100000: 29% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
1:32.816 default Q chaos_bolt Fluffy_Pillow 338749.9/1100000: 31% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos
1:35.119 default L service_imp Fluffy_Pillow 372163.0/1100000: 34% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
1:36.254 default G immolate Fluffy_Pillow 388701.4/1100000: 35% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
1:37.391 default J conflagrate Fluffy_Pillow 339269.0/1100000: 31% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
1:38.527 default K conflagrate Fluffy_Pillow 355822.1/1100000: 32% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando
1:39.665 default Q chaos_bolt Fluffy_Pillow 372404.2/1100000: 34% mana | 3.0/5: 60% soul_shard lord_of_flames, accelerando
1:41.934 default K conflagrate Fluffy_Pillow 405466.6/1100000: 37% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando
1:43.072 default C havoc enemy2 422048.8/1100000: 38% mana | 4.0/5: 80% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando
1:43.860 default Q chaos_bolt Fluffy_Pillow 345531.0/1100000: 31% mana | 4.0/5: 80% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando
1:44.804 default Q chaos_bolt Fluffy_Pillow 359428.0/1100000: 33% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(2)
1:45.736 default K conflagrate Fluffy_Pillow 373102.5/1100000: 34% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact
1:46.535 default Q chaos_bolt Fluffy_Pillow 384573.0/1100000: 35% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, nefarious_pact
1:47.495 default R incinerate Fluffy_Pillow 398354.8/1100000: 36% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, nefarious_pact
1:48.454 default R incinerate Fluffy_Pillow 346123.1/1100000: 31% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, nefarious_pact, accelerando
1:49.399 default R incinerate Fluffy_Pillow 293893.0/1100000: 27% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, nefarious_pact, accelerando
1:50.346 default R incinerate Fluffy_Pillow 241692.0/1100000: 22% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, nefarious_pact, accelerando
1:51.291 default K conflagrate Fluffy_Pillow 189461.9/1100000: 17% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, nefarious_pact, accelerando
1:52.079 default Q chaos_bolt Fluffy_Pillow 200944.2/1100000: 18% mana | 3.0/5: 60% soul_shard lord_of_flames, nefarious_pact, accelerando
1:53.652 default Q chaos_bolt Fluffy_Pillow 223864.9/1100000: 20% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, nefarious_pact, accelerando
1:54.597 default R incinerate Fluffy_Pillow 237634.8/1100000: 22% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos, devils_due, accelerando
1:56.201 default R incinerate Fluffy_Pillow 195007.2/1100000: 18% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos, devils_due, accelerando
1:57.806 default R incinerate Fluffy_Pillow 152394.2/1100000: 14% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos, devils_due, accelerando
1:59.410 default E immolate Fluffy_Pillow 109766.6/1100000: 10% mana | 2.0/5: 40% soul_shard lord_of_flames, devils_due, accelerando
2:00.749 default P dimensional_rift Fluffy_Pillow 63264.3/1100000: 6% mana | 2.0/5: 40% soul_shard lord_of_flames, devils_due, accelerando
2:02.089 default Q chaos_bolt Fluffy_Pillow 82789.8/1100000: 8% mana | 2.0/5: 40% soul_shard lord_of_flames, devils_due, accelerando
2:04.760 default C havoc enemy2 121709.9/1100000: 11% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos, accelerando
2:05.897 default S life_tap Fluffy_Pillow 50316.1/1100000: 5% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando(2)
2:07.017 default O soul_harvest Fluffy_Pillow 396877.4/1100000: 36% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando(2)
2:07.017 default I potion Fluffy_Pillow 396877.4/1100000: 36% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, embrace_chaos, accelerando(2)
2:07.017 default R incinerate Fluffy_Pillow 396877.4/1100000: 36% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, embrace_chaos, accelerando(2), potion_of_deadly_grace
2:08.360 default R incinerate Fluffy_Pillow 350817.7/1100000: 32% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, embrace_chaos, accelerando(3), potion_of_deadly_grace
2:09.682 default G immolate Fluffy_Pillow 304651.3/1100000: 28% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, accelerando(4), potion_of_deadly_grace
2:10.770 default J conflagrate Fluffy_Pillow 255208.3/1100000: 23% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, accelerando(4), potion_of_deadly_grace
2:11.857 default K conflagrate Fluffy_Pillow 271750.1/1100000: 25% mana | 2.0/5: 40% soul_shard soul_harvest, lord_of_flames, accelerando(4), potion_of_deadly_grace
2:12.945 default Q chaos_bolt Fluffy_Pillow 288075.0/1100000: 26% mana | 4.0/5: 80% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, potion_of_deadly_grace
2:15.247 default Q chaos_bolt Fluffy_Pillow 321122.5/1100000: 29% mana | 3.0/5: 60% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, potion_of_deadly_grace
2:16.630 default K conflagrate Fluffy_Pillow 340978.0/1100000: 31% mana | 2.0/5: 40% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando, potion_of_deadly_grace
2:17.766 default P dimensional_rift Fluffy_Pillow 357531.0/1100000: 33% mana | 5.0/5: 100% soul_shard soul_harvest, lord_of_flames, embrace_chaos, accelerando, potion_of_deadly_grace
2:18.901 default Q chaos_bolt Fluffy_Pillow 374069.5/1100000: 34% mana | 5.0/5: 100% soul_shard soul_harvest, lord_of_flames, embrace_chaos, accelerando, potion_of_deadly_grace
2:20.263 default Q chaos_bolt Fluffy_Pillow 393915.7/1100000: 36% mana | 4.0/5: 80% soul_shard soul_harvest, lord_of_flames, embrace_chaos, accelerando, potion_of_deadly_grace
2:21.624 default Q chaos_bolt Fluffy_Pillow 413747.2/1100000: 38% mana | 3.0/5: 60% soul_shard soul_harvest, lord_of_flames, embrace_chaos, accelerando, potion_of_deadly_grace
2:22.987 default K conflagrate Fluffy_Pillow 433609.0/1100000: 39% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, embrace_chaos, accelerando(2), potion_of_deadly_grace
2:24.106 default Q chaos_bolt Fluffy_Pillow 450155.6/1100000: 41% mana | 3.0/5: 60% soul_shard soul_harvest, lord_of_flames, embrace_chaos, accelerando(2), potion_of_deadly_grace
2:25.449 default C havoc enemy2 470014.5/1100000: 43% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, embrace_chaos, accelerando(2), potion_of_deadly_grace
2:26.570 default K conflagrate Fluffy_Pillow 398590.6/1100000: 36% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando(2), potion_of_deadly_grace
2:27.691 default Q chaos_bolt Fluffy_Pillow 415166.8/1100000: 38% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando(2), potion_of_deadly_grace
2:29.033 default R incinerate Fluffy_Pillow 434835.9/1100000: 40% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando, potion_of_deadly_grace
2:30.396 default Q chaos_bolt Fluffy_Pillow 388696.6/1100000: 35% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando, potion_of_deadly_grace
2:31.757 default Q chaos_bolt Fluffy_Pillow 408528.2/1100000: 37% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando, potion_of_deadly_grace
2:33.120 default E immolate Fluffy_Pillow 428390.0/1100000: 39% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando(2), potion_of_deadly_grace
2:34.239 default R incinerate Fluffy_Pillow 378936.6/1100000: 34% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando(2), potion_of_deadly_grace
2:35.582 default Q chaos_bolt Fluffy_Pillow 332796.3/1100000: 30% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando(3), potion_of_deadly_grace
2:36.906 default R incinerate Fluffy_Pillow 352659.3/1100000: 32% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos, accelerando(3), potion_of_deadly_grace
2:38.230 default R incinerate Fluffy_Pillow 306522.2/1100000: 28% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos, accelerando(3)
2:39.556 default R incinerate Fluffy_Pillow 260415.2/1100000: 24% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos, accelerando(3)
2:40.879 default R incinerate Fluffy_Pillow 214263.2/1100000: 19% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando(3)
2:42.203 default Q chaos_bolt Fluffy_Pillow 167368.6/1100000: 15% mana | 2.0/5: 40% soul_shard lord_of_flames, accelerando
2:44.474 default G immolate Fluffy_Pillow 200764.3/1100000: 18% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando(2)
2:45.595 default C havoc enemy2 151340.4/1100000: 14% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando(2)
2:46.715 default J conflagrate Fluffy_Pillow 79901.8/1100000: 7% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando(2)
2:47.836 default K conflagrate Fluffy_Pillow 96544.9/1100000: 9% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando(3)
2:48.940 default Q chaos_bolt Fluffy_Pillow 113107.4/1100000: 10% mana | 3.0/5: 60% soul_shard lord_of_flames, accelerando(3)
2:51.144 default Q chaos_bolt Fluffy_Pillow 146471.6/1100000: 13% mana | 3.0/5: 60% soul_shard lord_of_flames, embrace_chaos, accelerando(4)
2:52.449 default F immolate enemy2 166330.8/1100000: 15% mana | 3.0/5: 60% soul_shard lord_of_flames, embrace_chaos, accelerando(4)
2:53.536 default Q chaos_bolt Fluffy_Pillow 116872.6/1100000: 11% mana | 4.0/5: 80% soul_shard lord_of_flames, embrace_chaos, accelerando(4)
2:54.841 default K conflagrate Fluffy_Pillow 136177.8/1100000: 12% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos
2:55.993 default Q chaos_bolt Fluffy_Pillow 152715.9/1100000: 14% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
2:57.375 default K conflagrate Fluffy_Pillow 172555.9/1100000: 16% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
2:58.527 default Q chaos_bolt Fluffy_Pillow 189094.1/1100000: 17% mana | 4.0/5: 80% soul_shard lord_of_flames, embrace_chaos
2:59.909 default Q chaos_bolt Fluffy_Pillow 208935.0/1100000: 19% mana | 3.0/5: 60% soul_shard lord_of_flames, embrace_chaos, accelerando
3:01.272 default K conflagrate Fluffy_Pillow 228795.7/1100000: 21% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando
3:02.409 default P dimensional_rift Fluffy_Pillow 245363.3/1100000: 22% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
3:03.546 default H berserking Fluffy_Pillow 261930.9/1100000: 24% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
3:03.546 default Q chaos_bolt Fluffy_Pillow 261930.9/1100000: 24% mana | 2.0/5: 40% soul_shard berserking, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
3:04.732 default R incinerate Fluffy_Pillow 281804.7/1100000: 26% mana | 1.0/5: 20% soul_shard berserking, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
3:05.918 default C havoc enemy2 235678.6/1100000: 21% mana | 1.0/5: 20% soul_shard berserking, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
3:06.906 default L service_imp Fluffy_Pillow 164234.5/1100000: 15% mana | 1.0/5: 20% soul_shard berserking, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
3:07.895 default E immolate Fluffy_Pillow 180807.2/1100000: 16% mana | 0.0/5: 0% soul_shard berserking, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
3:08.885 default R incinerate Fluffy_Pillow 131396.7/1100000: 12% mana | 0.0/5: 0% soul_shard berserking, lord_of_flames, conflagration_of_chaos, accelerando
3:10.071 default R incinerate Fluffy_Pillow 85271.8/1100000: 8% mana | 0.0/5: 0% soul_shard berserking, lord_of_flames, conflagration_of_chaos, accelerando(2)
3:11.238 default S life_tap Fluffy_Pillow 39116.6/1100000: 4% mana | 1.0/5: 20% soul_shard berserking, lord_of_flames, conflagration_of_chaos, accelerando(2)
3:12.211 default R incinerate Fluffy_Pillow 385510.8/1100000: 35% mana | 1.0/5: 20% soul_shard berserking, lord_of_flames, conflagration_of_chaos
3:13.415 default R incinerate Fluffy_Pillow 339388.2/1100000: 31% mana | 1.0/5: 20% soul_shard berserking, lord_of_flames, conflagration_of_chaos
3:14.619 default R incinerate Fluffy_Pillow 290956.0/1100000: 26% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, accelerando
3:15.982 default G immolate Fluffy_Pillow 244816.7/1100000: 22% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, accelerando
3:17.118 default J conflagrate Fluffy_Pillow 195369.7/1100000: 18% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, accelerando
3:18.254 default Q chaos_bolt Fluffy_Pillow 211922.8/1100000: 19% mana | 3.0/5: 60% soul_shard lord_of_flames, accelerando
3:20.524 default K conflagrate Fluffy_Pillow 245001.0/1100000: 22% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando(2)
3:21.641 default Q chaos_bolt Fluffy_Pillow 261518.0/1100000: 24% mana | 3.0/5: 60% soul_shard lord_of_flames, embrace_chaos, accelerando(2)
3:22.983 default K conflagrate Fluffy_Pillow 281362.1/1100000: 26% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando(2)
3:24.101 default Q chaos_bolt Fluffy_Pillow 297933.0/1100000: 27% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando(3)
3:25.426 default K conflagrate Fluffy_Pillow 317812.3/1100000: 29% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos, accelerando(4)
3:26.514 default C havoc enemy2 334369.3/1100000: 30% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando(4)
3:27.602 default R incinerate Fluffy_Pillow 262074.9/1100000: 24% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos
3:28.985 default Q chaos_bolt Fluffy_Pillow 215929.2/1100000: 20% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos
3:30.370 default R incinerate Fluffy_Pillow 235812.3/1100000: 21% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos
3:31.753 default K conflagrate Fluffy_Pillow 189667.6/1100000: 17% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando
3:32.997 default Q chaos_bolt Fluffy_Pillow 207794.3/1100000: 19% mana | 4.0/5: 80% soul_shard lord_of_flames, embrace_chaos, accelerando
3:34.360 default Q chaos_bolt Fluffy_Pillow 227655.0/1100000: 21% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando
3:35.722 default R incinerate Fluffy_Pillow 247501.2/1100000: 23% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando
3:37.084 default R incinerate Fluffy_Pillow 201347.4/1100000: 18% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando
3:38.447 default E immolate Fluffy_Pillow 155208.1/1100000: 14% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando
3:39.584 default Q chaos_bolt Fluffy_Pillow 105798.1/1100000: 10% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando(2)
3:40.926 default Q chaos_bolt Fluffy_Pillow 125642.2/1100000: 11% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando(2)
3:42.269 default R incinerate Fluffy_Pillow 145501.0/1100000: 13% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos, accelerando(2)
3:43.612 default R incinerate Fluffy_Pillow 99359.9/1100000: 9% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos, accelerando(2)
3:44.957 default S life_tap Fluffy_Pillow 52727.8/1100000: 5% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos
3:46.110 default P dimensional_rift Fluffy_Pillow 399280.3/1100000: 36% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos
3:47.263 default C havoc enemy2 415832.8/1100000: 38% mana | 1.0/5: 20% soul_shard lord_of_flames
3:48.417 default R incinerate Fluffy_Pillow 344399.6/1100000: 31% mana | 1.0/5: 20% soul_shard lord_of_flames
3:49.800 default R incinerate Fluffy_Pillow 298526.2/1100000: 27% mana | 1.0/5: 20% soul_shard lord_of_flames, accelerando(2)
3:51.145 default G immolate Fluffy_Pillow 252414.6/1100000: 23% mana | 1.0/5: 20% soul_shard lord_of_flames, accelerando(2)
3:52.264 default J conflagrate Fluffy_Pillow 202962.1/1100000: 18% mana | 1.0/5: 20% soul_shard lord_of_flames, accelerando(3)
3:53.368 default N summon_doomguard Fluffy_Pillow 219540.7/1100000: 20% mana | 3.0/5: 60% soul_shard lord_of_flames, accelerando(4)
3:54.455 default K conflagrate Fluffy_Pillow 236082.5/1100000: 21% mana | 2.0/5: 40% soul_shard lord_of_flames, accelerando(4)
3:55.544 default Q chaos_bolt Fluffy_Pillow 252654.8/1100000: 23% mana | 4.0/5: 80% soul_shard lord_of_flames, accelerando(4)
3:57.718 default Q chaos_bolt Fluffy_Pillow 286057.6/1100000: 26% mana | 3.0/5: 60% soul_shard lord_of_flames, embrace_chaos, accelerando(5)
3:59.005 default K conflagrate Fluffy_Pillow 305920.1/1100000: 28% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando(5)
4:00.079 default K conflagrate Fluffy_Pillow 322495.3/1100000: 29% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando(5)
4:01.154 default Q chaos_bolt Fluffy_Pillow 338665.8/1100000: 31% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
4:02.537 default R incinerate Fluffy_Pillow 358649.6/1100000: 33% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
4:03.899 default R incinerate Fluffy_Pillow 312495.8/1100000: 28% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
4:05.262 default R incinerate Fluffy_Pillow 266356.5/1100000: 24% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
4:06.625 default K conflagrate Fluffy_Pillow 220217.2/1100000: 20% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, accelerando
4:07.761 default C havoc enemy2 236770.3/1100000: 22% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, accelerando
4:08.898 default O soul_harvest Fluffy_Pillow 165337.9/1100000: 15% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, accelerando
4:08.898 default Q chaos_bolt Fluffy_Pillow 165337.9/1100000: 15% mana | 2.0/5: 40% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, accelerando
4:11.168 default R incinerate Fluffy_Pillow 198416.1/1100000: 18% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
4:12.511 default R incinerate Fluffy_Pillow 152275.0/1100000: 14% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
4:13.853 default E immolate Fluffy_Pillow 106119.0/1100000: 10% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
4:14.972 default S life_tap Fluffy_Pillow 56219.2/1100000: 5% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos
4:16.127 default R incinerate Fluffy_Pillow 402800.4/1100000: 37% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos
4:17.512 default Q chaos_bolt Fluffy_Pillow 356683.5/1100000: 32% mana | 2.0/5: 40% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos
4:19.815 default R incinerate Fluffy_Pillow 389745.4/1100000: 35% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact
4:20.775 default R incinerate Fluffy_Pillow 337528.3/1100000: 31% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando
4:21.720 default R incinerate Fluffy_Pillow 285298.2/1100000: 26% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando
4:22.667 default R incinerate Fluffy_Pillow 233097.2/1100000: 21% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando
4:23.613 default Q chaos_bolt Fluffy_Pillow 180881.7/1100000: 16% mana | 2.0/5: 40% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando
4:24.558 default G immolate Fluffy_Pillow 194711.6/1100000: 18% mana | 0.0/5: 0% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(2)
4:25.335 default J conflagrate Fluffy_Pillow 140306.1/1100000: 13% mana | 0.0/5: 0% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(3)
4:26.103 default K conflagrate Fluffy_Pillow 151827.8/1100000: 14% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(3)
4:26.869 default K conflagrate Fluffy_Pillow 163319.5/1100000: 15% mana | 2.0/5: 40% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(3)
4:27.635 default Q chaos_bolt Fluffy_Pillow 174811.2/1100000: 16% mana | 3.0/5: 60% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(3)
4:28.555 default C havoc enemy2 188613.3/1100000: 17% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(3)
4:29.321 default R incinerate Fluffy_Pillow 112105.0/1100000: 10% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(3)
4:30.237 default S life_tap Fluffy_Pillow 59847.5/1100000: 5% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due, accelerando(4)
4:31.518 default P dimensional_rift Fluffy_Pillow 409341.6/1100000: 37% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due, accelerando(4)
4:32.800 default K conflagrate Fluffy_Pillow 428825.0/1100000: 39% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, devils_due
4:34.160 default Q chaos_bolt Fluffy_Pillow 448642.0/1100000: 41% mana | 4.0/5: 80% soul_shard lord_of_flames, devils_due, accelerando
4:36.832 default L service_imp Fluffy_Pillow 487576.6/1100000: 44% mana | 3.0/5: 60% soul_shard lord_of_flames, embrace_chaos, devils_due, accelerando
4:38.243 default Q chaos_bolt Fluffy_Pillow 508136.7/1100000: 46% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando
4:39.605 default J conflagrate Fluffy_Pillow 528261.7/1100000: 48% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos, accelerando(2)
4:40.724 default Q chaos_bolt Fluffy_Pillow 544808.2/1100000: 50% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
4:42.066 default R incinerate Fluffy_Pillow 564652.3/1100000: 51% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
4:43.410 default Q chaos_bolt Fluffy_Pillow 518525.9/1100000: 47% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
4:44.753 default R incinerate Fluffy_Pillow 538384.8/1100000: 49% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
4:46.099 default J conflagrate Fluffy_Pillow 491728.3/1100000: 45% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
4:47.253 default E immolate Fluffy_Pillow 508295.1/1100000: 46% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos
4:48.407 default R incinerate Fluffy_Pillow 459092.6/1100000: 42% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando
4:49.769 default C havoc enemy2 412938.7/1100000: 38% mana | 3.0/5: 60% soul_shard lord_of_flames, accelerando
4:50.906 default Q chaos_bolt Fluffy_Pillow 341506.3/1100000: 31% mana | 3.0/5: 60% soul_shard lord_of_flames, accelerando
4:53.177 default J conflagrate Fluffy_Pillow 375068.3/1100000: 34% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando(2)
4:54.298 default Q chaos_bolt Fluffy_Pillow 391644.4/1100000: 36% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando(2)
4:55.639 default R incinerate Fluffy_Pillow 411473.7/1100000: 37% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos, accelerando(2)
4:56.982 default R incinerate Fluffy_Pillow 365332.5/1100000: 33% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos, accelerando(2)
4:58.325 default R incinerate Fluffy_Pillow 319328.5/1100000: 29% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos, accelerando(3)
4:59.649 default J conflagrate Fluffy_Pillow 272989.2/1100000: 25% mana | 0.0/5: 0% soul_shard lord_of_flames
5:00.803 default Q chaos_bolt Fluffy_Pillow 289556.1/1100000: 26% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4201 3876 0
Agility 7254 6929 0
Stamina 52943 52943 34467
Intellect 50545 48839 39190 (1278)
Spirit 1 1 0
Health 3176580 3176580 0
Mana 1100000 1100000 0
Soul Shard 5 5 0
Spell Power 50545 48839 0
Crit 13.94% 13.94% 3577
Haste 30.51% 29.51% 11066
Damage / Heal Versatility 5.96% 5.96% 2829
ManaReg per Second 14356 14246 0
Mastery 66.72% 66.72% 5695
Armor 1981 1981 1981
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 906.00
Local Head Eyes of Azj'Aqir
ilevel: 900, stats: { 253 Armor, +3255 Sta, +2170 Int, +1074 Haste, +578 Vers }
Local Neck Radiant String of Scorpid Eyes
ilevel: 900, stats: { +1831 Sta, +2011 Haste, +922 Crit }, enchant: mark_of_the_hidden_satyr
Local Shoulders Pauldrons of Azj'Aqir
ilevel: 900, stats: { 233 Armor, +2442 Sta, +1628 Int, +752 Mastery, +487 Vers }
Local Chest Robes of Fluctuating Energy
ilevel: 900, stats: { 311 Armor, +3255 Sta, +2170 Int, +1145 Haste, +507 Mastery }
Local Waist Feretory of Souls
ilevel: 940, stats: { 202 Armor, +3544 Sta, +2362 Int, +822 Haste, +617 Mastery }
Local Legs Leggings of Azj'Aqir
ilevel: 900, stats: { 272 Armor, +3255 Sta, +2170 Int, +932 Crit, +720 Haste }
Local Feet Outcast Wanderer's Footrags
ilevel: 910, stats: { 222 Armor, +2680 Sta, +1786 Int, +864 Crit, +422 Mastery }
Local Wrists Woven Lasher Tendril Bracers
ilevel: 900, stats: { 136 Armor, +1831 Sta, +1221 Int, +644 Haste, +285 Vers }
Local Hands Clutch of Azj'Aqir
ilevel: 900, stats: { 194 Armor, +2442 Sta, +1628 Int, +859 Crit, +380 Mastery }
Local Finger1 Ring of the Scoured Clan
ilevel: 900, stats: { +1831 Sta, +2095 Mastery, +838 Haste }, enchant: { +200 Haste }
Local Finger2 Ring of Braided Stems
ilevel: 905, stats: { +1918 Sta, +1814 Haste, +1209 Vers }, enchant: { +200 Haste }
Local Trinket1 Whispers in the Dark
ilevel: 905, stats: { +2162 Int }
Local Trinket2 Erratic Metronome
ilevel: 900, stats: { +2063 Int }
Local Back Astromancer's Greatcloak
ilevel: 905, stats: { 158 Armor, +1918 Sta, +1278 StrAgiInt, +676 Haste, +270 Vers }, enchant: { +200 Int }
Local Main Hand Scepter of Sargeras
ilevel: 929, weapon: { 7005 - 10509, 3.6 }, stats: { +2843 Int, +4265 Sta, +922 Haste, +922 Mastery, +15509 Int }, relics: { +61 ilevels, +59 ilevels, +61 ilevels }

Talents

Level
15 Backdraft (Destruction Warlock) Roaring Blaze (Destruction Warlock) Shadowburn (Destruction Warlock)
30 Reverse Entropy (Destruction Warlock) Eradication (Destruction Warlock) Empowered Life Tap
45 Demonic Circle Mortal Coil Shadowfury
60 Cataclysm (Destruction Warlock) Fire and Brimstone (Destruction Warlock) Soul Harvest
75 Demon Skin Burning Rush Dark Pact
90 Grimoire of Supremacy Grimoire of Service Grimoire of Sacrifice
100 Wreak Havoc (Destruction Warlock) Channel Demonfire (Destruction Warlock) Soul Conduit

Profile

warlock="Feretory"
level=110
race=troll
role=spell
position=back
talents=2203021
artifact=38:142513:142516:142513:0:803:1:804:3:805:3:806:5:807:3:808:3:809:4:810:3:811:3:812:3:813:1:814:1:815:1:816:1:817:1:818:1:1355:1
spec=destruction

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,type=whispered_pact
actions.precombat+=/food,type=azshari_salad
actions.precombat+=/summon_pet,if=!talent.grimoire_of_supremacy.enabled&(!talent.grimoire_of_sacrifice.enabled|buff.demonic_power.down)
actions.precombat+=/summon_infernal,if=talent.grimoire_of_supremacy.enabled&artifact.lord_of_flames.rank>0
actions.precombat+=/summon_infernal,if=talent.grimoire_of_supremacy.enabled&active_enemies>1
actions.precombat+=/summon_doomguard,if=talent.grimoire_of_supremacy.enabled&active_enemies=1&artifact.lord_of_flames.rank=0
actions.precombat+=/augmentation,type=defiled
actions.precombat+=/snapshot_stats
actions.precombat+=/grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
actions.precombat+=/life_tap,if=talent.empowered_life_tap.enabled&!buff.empowered_life_tap.remains
actions.precombat+=/potion,name=prolonged_power
actions.precombat+=/chaos_bolt

# Executed every time the actor is available.
actions=havoc,target=2,if=active_enemies>1&(active_enemies<4|talent.wreak_havoc.enabled&active_enemies<6)&!debuff.havoc.remains
actions+=/dimensional_rift,if=charges=3
actions+=/immolate,if=remains<=tick_time
actions+=/immolate,cycle_targets=1,if=active_enemies>1&remains<=tick_time&(!talent.roaring_blaze.enabled|(!debuff.roaring_blaze.remains&action.conflagrate.charges<2))
actions+=/immolate,if=talent.roaring_blaze.enabled&remains<=duration&!debuff.roaring_blaze.remains&target.time_to_die>10&(action.conflagrate.charges=2+set_bonus.tier19_4pc|(action.conflagrate.charges>=1+set_bonus.tier19_4pc&action.conflagrate.recharge_time<cast_time+gcd)|target.time_to_die<24)
actions+=/berserking
actions+=/blood_fury
actions+=/arcane_torrent
actions+=/potion,name=deadly_grace,if=(buff.soul_harvest.remains|trinket.proc.any.react|target.time_to_die<=45)
actions+=/shadowburn,if=buff.conflagration_of_chaos.remains<=action.chaos_bolt.cast_time
actions+=/shadowburn,if=(charges=1&recharge_time<action.chaos_bolt.cast_time|charges=2)&soul_shard<5
actions+=/conflagrate,if=talent.roaring_blaze.enabled&(charges=2+set_bonus.tier19_4pc|(charges>=1+set_bonus.tier19_4pc&recharge_time<gcd)|target.time_to_die<24)
actions+=/conflagrate,if=talent.roaring_blaze.enabled&debuff.roaring_blaze.stack>0&dot.immolate.remains>dot.immolate.duration*0.3&(active_enemies=1|soul_shard<3)&soul_shard<5
actions+=/conflagrate,if=!talent.roaring_blaze.enabled&!buff.backdraft.remains&buff.conflagration_of_chaos.remains<=action.chaos_bolt.cast_time
actions+=/conflagrate,if=!talent.roaring_blaze.enabled&!buff.backdraft.remains&(charges=1&recharge_time<action.chaos_bolt.cast_time|charges=2)&soul_shard<5
actions+=/life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<=gcd
actions+=/dimensional_rift,if=equipped.144369&!buff.lessons_of_spacetime.remains&((!talent.grimoire_of_supremacy.enabled&!cooldown.summon_doomguard.remains)|(talent.grimoire_of_service.enabled&!cooldown.service_pet.remains)|(talent.soul_harvest.enabled&!cooldown.soul_harvest.remains))
actions+=/service_pet
actions+=/summon_infernal,if=artifact.lord_of_flames.rank>0&!buff.lord_of_flames.remains
actions+=/summon_doomguard,if=!talent.grimoire_of_supremacy.enabled&spell_targets.infernal_awakening<=2&(target.time_to_die>180|target.health.pct<=20|target.time_to_die<30)
actions+=/summon_infernal,if=!talent.grimoire_of_supremacy.enabled&spell_targets.infernal_awakening>2
actions+=/summon_doomguard,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal=1&artifact.lord_of_flames.rank>0&buff.lord_of_flames.remains&!pet.doomguard.active
actions+=/summon_doomguard,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal=1&equipped.132379&!cooldown.sindorei_spite_icd.remains
actions+=/summon_infernal,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal>1&equipped.132379&!cooldown.sindorei_spite_icd.remains
actions+=/soul_harvest
actions+=/channel_demonfire,if=dot.immolate.remains>cast_time
actions+=/havoc,if=active_enemies=1&talent.wreak_havoc.enabled&equipped.132375&!debuff.havoc.remains
actions+=/rain_of_fire,if=active_enemies>=3&cooldown.havoc.remains<=12&!talent.wreak_havoc.enabled
actions+=/rain_of_fire,if=active_enemies>=6&talent.wreak_havoc.enabled
actions+=/dimensional_rift,if=!equipped.144369|charges>1|((!talent.grimoire_of_service.enabled|recharge_time<cooldown.service_pet.remains)&(!talent.soul_harvest.enabled|recharge_time<cooldown.soul_harvest.remains)&(!talent.grimoire_of_supremacy.enabled|recharge_time<cooldown.summon_doomguard.remains))
actions+=/life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<duration*0.3
actions+=/cataclysm
actions+=/chaos_bolt,if=(cooldown.havoc.remains>12&cooldown.havoc.remains|active_enemies<3|talent.wreak_havoc.enabled&active_enemies<6)
actions+=/shadowburn
actions+=/conflagrate,if=!talent.roaring_blaze.enabled&!buff.backdraft.remains
actions+=/immolate,if=!talent.roaring_blaze.enabled&remains<=duration*0.3
actions+=/incinerate
actions+=/life_tap

head=eyes_of_azjaqir,id=138314,bonus_id=3445
neck=radiant_string_of_scorpid_eyes,id=140898,bonus_id=3445,enchant_id=5439
shoulders=pauldrons_of_azjaqir,id=138323,bonus_id=3445
back=astromancers_greatcloak,id=140909,bonus_id=3518,enchant_id=5436
chest=robes_of_fluctuating_energy,id=140848,bonus_id=3445
wrists=woven_lasher_tendril_bracers,id=140886,bonus_id=3445
hands=clutch_of_azjaqir,id=138311,bonus_id=3445
waist=feretory_of_souls,id=132456,ilevel=940
legs=leggings_of_azjaqir,id=138317,bonus_id=3445
feet=outcast_wanderers_footrags,id=140914,bonus_id=3519
finger1=ring_of_the_scoured_clan,id=140897,bonus_id=3445,enchant=binding_of_haste
finger2=ring_of_braided_stems,id=140896,bonus_id=3518,enchant=binding_of_haste
trinket1=whispers_in_the_dark,id=140809,ilevel=905
trinket2=erratic_metronome,id=140792,ilevel=900
main_hand=scepter_of_sargeras,id=128941,ilevel=929,gem_id=140826/140837/140826,relic_id=3519/3518:3518/3519

# Gear Summary
# gear_ilvl=906.27
# gear_stamina=34467
# gear_intellect=39190
# gear_crit_rating=3577
# gear_haste_rating=11066
# gear_mastery_rating=5695
# gear_versatility_rating=2829
# gear_armor=1981
# set_bonus=tier19_2pc=1
# set_bonus=tier19_4pc=1
default_pet=imp

KJ_Trinket : 1015238 dps, 593844 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
1015237.8 1015237.8 0.0 / 0.000% 0.0 / 0.0% 32.2
RPS Out RPS In Primary Resource Waiting APM Active Skill
26004.3 26004.3 Mana 0.00% 51.0 100.0% 100%
Talents
  • 15: Roaring Blaze (Destruction Warlock)
  • 30: Eradication (Destruction Warlock)
  • 60: Soul Harvest
  • 90: Grimoire of Service
  • 100: Wreak Havoc (Destruction Warlock)
  • Talent Calculator
Artifact

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
KJ_Trinket 1015238
Chaos Bolt 320059 31.6% 56.8 5.15sec 1695607 1102458 Direct 108.1 0 890436 890436 100.0%  

Stats details: chaos_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 56.77 108.10 0.00 0.00 1.5380 0.0000 96258895.44 96258895.44 0.00 1102457.77 1102457.77
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 108.10 100.00% 890436.39 575648 1379750 890681.49 834420 955154 96258895 96258895 0.00
 
 

Action details: chaos_bolt

Static Values
  • id:116858
  • school:chromatic
  • resource:soul_shard
  • range:40.0
  • travel_speed:16.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:2.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:116858
  • name:Chaos Bolt
  • school:chromatic
  • tooltip:
  • description:Unleashes a devastating blast of chaos, causing {$s1=1} Chaos damage. Chaos Bolt always critically strikes and your critical strike chance increases its damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:4.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Conflagrate 107880 10.6% 47.9 6.27sec 676380 644445 Direct 95.3 201202 455718 339989 54.5%  

Stats details: conflagrate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 47.90 95.30 0.00 0.00 1.0496 0.0000 32401413.97 32401413.97 0.00 644445.16 644445.16
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 43.34 45.47% 201202.40 131769 315837 201314.83 180804 226350 8719186 8719186 0.00
crit 51.97 54.53% 455718.19 263544 726941 455871.00 400370 507303 23682228 23682228 0.00
 
 

Action details: conflagrate

Static Values
  • id:17962
  • school:fire
  • resource:chi
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:9.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.roaring_blaze.enabled&(charges=2+set_bonus.tier19_4pc|(charges>=1+set_bonus.tier19_4pc&recharge_time<gcd)|target.time_to_die<24)
Spelldata
  • id:17962
  • name:Conflagrate
  • school:fire
  • tooltip:
  • description:Triggers an explosion on the target, dealing {$s1=1} Fire damage.{$?s196406=false}[ Reduces the cast time of Incinerate and Chaos Bolt by {$117828s1=30}% for {$117828d=10 seconds}.][] |cFFFFFFFFGenerates 1 Soul Shard.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.265510
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Deadly Grace 5204 0.5% 14.1 2.10sec 108769 0 Direct 14.1 94523 189162 108769 15.1%  

Stats details: deadly_grace

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.12 14.12 0.00 0.00 0.0000 0.0000 1536349.48 1536349.48 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 12.00 84.95% 94523.37 83888 100666 94530.54 85986 100666 1134158 1134158 0.00
crit 2.13 15.05% 189162.43 167777 201332 168826.71 0 201332 402191 402191 0.00
 
 

Action details: deadly_grace

Static Values
  • id:188091
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:25.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188091
  • name:Deadly Grace
  • school:arcane
  • tooltip:
  • description:Deal {$s1=63339 to 95008} Arcane damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:63338.72
  • base_dd_max:95008.08
 
Immolate 237443 23.4% 19.8 15.42sec 3606722 3391117 Direct 38.3 138488 276855 203373 46.9%  
Periodic 290.1 148871 297983 219017 47.0% 195.8%

Stats details: immolate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 19.78 38.31 290.08 290.08 1.0636 2.0329 71325367.37 71325367.37 0.00 116785.16 3391117.17
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 20.35 53.11% 138488.05 91421 218904 138488.86 117376 157745 2817552 2817552 0.00
crit 17.96 46.89% 276855.25 182842 438240 276838.37 234595 324436 4973669 4973669 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 153.6 52.96% 148870.55 50 435350 149116.78 129589 174834 22869864 22869864 0.00
crit 136.5 47.04% 297983.17 169 870698 298495.03 248876 355155 40664282 40664282 0.00
 
 

Action details: immolate

Static Values
  • id:348
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:66000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.32
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:remains<=tick_time
Spelldata
  • id:348
  • name:Immolate
  • school:fire
  • tooltip:
  • description:Burns the enemy, causing {$s1=1} Fire damage immediately and an additional $157736o1 Fire damage over {$157736d=18 seconds}. |cFFFFFFFFPeriodic damage has a {$193541s1=15}% chance to generate 1 Soul Shard. Chance doubled on critical strikes.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.332000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.721500
  • base_td:0.00
  • dot_duration:18.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Incinerate 133875 13.2% 79.0 3.62sec 509846 409021 Direct 151.7 230758 461680 265579 15.1%  

Stats details: incinerate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 79.03 151.73 0.00 0.00 1.2465 0.0000 40295157.90 40295157.90 0.00 409021.46 409021.46
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 128.85 84.92% 230757.56 147780 354208 230815.97 216119 246582 29732542 29732542 0.00
crit 22.88 15.08% 461680.32 295562 708418 461833.34 388509 535027 10562616 10562616 0.00
 
 

Action details: incinerate

Static Values
  • id:29722
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:66000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:29722
  • name:Incinerate
  • school:fire
  • tooltip:
  • description:Draws fire toward the enemy, dealing {$s2=0} Fire damage.{$?s29722=true}|!c3[][ Replaces Shadow Bolt.]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.331000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Kil'jaeden's Burning Wish 25044 2.5% 4.5 75.50sec 1671926 0 Direct 8.9 0 838600 838600 100.0%  

Stats details: kiljaedens_burning_wish

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.48 8.94 0.00 0.00 0.0000 0.0000 7496995.10 7496995.10 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 8.94 100.00% 838600.00 838600 838600 838600.00 838600 838600 7496995 7496995 0.00
 
 

Action details: kiljaedens_burning_wish

Static Values
  • id:235999
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:29.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:235999
  • name:Kil'jaeden's Burning Wish
  • school:fire
  • tooltip:
  • description:{$@spelldesc235991=Launch a vortex of destruction that seeks your current enemy. When it reaches the target, it explodes, dealing a critical strike to all enemies within $235999A1 yds for ${{$235999s1=112984 to 124877}*{$s2=200}/100} Fire damage.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:419300.00
  • base_dd_max:419300.00
 
Mark of the Hidden Satyr 8906 0.9% 19.8 15.22sec 135263 0 Direct 19.8 117353 234690 135262 15.3%  

Stats details: mark_of_the_hidden_satyr

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 19.79 19.79 0.00 0.00 0.0000 0.0000 2677157.13 2677157.13 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 16.77 84.74% 117353.18 111851 141164 117382.70 111851 130043 1968135 1968135 0.00
crit 3.02 15.26% 234689.61 223703 282328 222902.95 0 282328 709022 709022 0.00
 
 

Action details: mark_of_the_hidden_satyr

Static Values
  • id:191259
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191259
  • name:Mark of the Hidden Satyr
  • school:fire
  • tooltip:
  • description:Deals fire damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:2.500000
  • spell_power_mod.direct:2.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
pet - imp 42211 / 42211
Firebolt 42211 4.2% 107.6 2.80sec 117916 95872 Direct 106.8 103225 206444 118824 15.1%  

Stats details: firebolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 107.61 106.79 0.00 0.00 1.2299 0.0000 12688990.52 12688990.52 0.00 95871.61 95871.61
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 90.65 84.89% 103225.20 65994 124932 103253.31 100456 105405 9357606 9357606 0.00
crit 16.14 15.11% 206444.08 131987 249865 206506.43 186871 228360 3331385 3331385 0.00
 
 

Action details: firebolt

Static Values
  • id:3110
  • school:fire
  • resource:energy
  • range:40.0
  • travel_speed:16.0000
  • trigger_gcd:0.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.75
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:3110
  • name:Firebolt
  • school:fire
  • tooltip:
  • description:Deals {$s1=1} Fire damage to a target.$?a231795[ Damage increased by {$231795s1=50}% if you have Immolated the target.][] |cFF777777(Right-Click to toggle)|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
pet - service_imp 121420 / 38738
Firebolt 121420 3.8% 48.1 5.64sec 241085 209196 Direct 47.9 210506 421030 242426 15.2%  

Stats details: firebolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 48.13 47.87 0.00 0.00 1.1524 0.0000 11604122.87 11604122.87 0.00 209196.37 209196.37
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 40.61 84.84% 210506.16 131987 249865 210704.63 202035 218662 8548069 8548069 0.00
crit 7.26 15.16% 421030.40 263974 499729 421125.63 0 499729 3056053 3056053 0.00
 
 

Action details: firebolt

Static Values
  • id:3110
  • school:fire
  • resource:energy
  • range:40.0
  • travel_speed:16.0000
  • trigger_gcd:0.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.75
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:3110
  • name:Firebolt
  • school:fire
  • tooltip:
  • description:Deals {$s1=1} Fire damage to a target.$?a231795[ Damage increased by {$231795s1=50}% if you have Immolated the target.][] |cFF777777(Right-Click to toggle)|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
pet - infernal 116146 / 9834
Immolation 90431 0.7% 1.0 0.00sec 2260860 0 Periodic 46.3 42455 84893 48874 15.1% 8.2%

Stats details: immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 23.13 46.26 0.0000 1.0619 2260859.69 2260859.69 0.00 92054.55 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 39.3 84.87% 42455.03 36761 44114 42452.91 41424 43612 1666864 1666864 0.00
crit 7.0 15.13% 84893.13 73523 88227 84829.40 0 88227 593996 593996 0.00
 
 

Action details: immolation

Static Values
  • id:19483
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!ticking
Spelldata
  • id:19483
  • name:Immolation
  • school:fire
  • tooltip:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
 

Action details: immolation_tick

Static Values
  • id:20153
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all enemies near the caster.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
melee 25715 0.2% 22.0 1.12sec 29223 26151 Direct 22.0 25382 50790 29223 15.1%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.00 22.00 0.00 0.00 1.1175 0.0000 642902.04 945126.89 31.98 26151.24 26151.24
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 18.67 84.88% 25382.35 21983 26380 25382.14 24689 26380 474005 696832 31.98
crit 3.33 15.12% 50789.76 43967 52760 49383.83 0 52760 168897 248295 31.10
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
pet - doomguard 92647 / 7846
Doom Bolt 92647 0.8% 10.5 2.22sec 219751 100978 Direct 10.5 190832 381652 219758 15.2%  

Stats details: doom_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.54 10.54 0.00 0.00 2.1762 0.0000 2316228.96 2316228.96 0.00 100977.81 100977.81
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 8.94 84.84% 190831.83 184556 221467 190880.38 184556 221467 1706380 1706380 0.00
crit 1.60 15.16% 381652.13 369112 442934 314559.23 0 442934 609849 609849 0.00
 
 

Action details: doom_bolt

Static Values
  • id:85692
  • school:shadow
  • resource:energy
  • range:30.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:35.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:85692
  • name:Doom Bolt
  • school:shadow
  • tooltip:
  • description:Sends a shadowy bolt at the enemy, causing {$s1=1} Shadow damage. Deals {$s2=20}% additional damage to targets below 20% health.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
pet - lord_of_flames_infernal 116114 / 9832
Immolation 90412 0.7% 1.0 0.00sec 2260388 0 Periodic 46.3 42455 84891 48864 15.1% 8.2%

Stats details: immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 23.13 46.26 0.0000 1.0619 2260387.63 2260387.63 0.00 92035.33 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 39.3 84.90% 42455.19 36761 44114 42452.77 41405 43764 1667336 1667336 0.00
crit 7.0 15.10% 84891.37 73523 88227 84845.30 0 88227 593052 593052 0.00
 
 

Action details: immolation

Static Values
  • id:19483
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!ticking
Spelldata
  • id:19483
  • name:Immolation
  • school:fire
  • tooltip:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
 

Action details: immolation_tick

Static Values
  • id:20153
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all enemies near the caster.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
melee 25702 0.2% 22.0 1.12sec 29208 26138 Direct 22.0 25383 50781 29207 15.1%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.00 22.00 0.00 0.00 1.1175 0.0000 642568.30 944636.26 31.98 26137.66 26137.66
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 18.69 84.94% 25383.11 21983 26380 25382.79 24689 26380 474339 697323 31.98
crit 3.31 15.06% 50781.32 43967 52760 49389.03 0 52760 168230 247314 31.11
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
pet - lord_of_flames_infernal 116181 / 9838
Immolation 90452 0.7% 1.0 0.00sec 2261391 0 Periodic 46.3 42457 84875 48886 15.2% 8.2%

Stats details: immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 23.13 46.26 0.0000 1.0619 2261390.58 2261390.58 0.00 92076.16 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 39.2 84.84% 42456.65 36761 44114 42454.26 41378 43612 1666333 1666333 0.00
crit 7.0 15.16% 84875.11 73523 88227 84830.49 0 88227 595058 595058 0.00
 
 

Action details: immolation

Static Values
  • id:19483
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!ticking
Spelldata
  • id:19483
  • name:Immolation
  • school:fire
  • tooltip:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
 

Action details: immolation_tick

Static Values
  • id:20153
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all enemies near the caster.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
melee 25729 0.2% 22.0 1.12sec 29238 26165 Direct 22.0 25383 50781 29238 15.2%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.00 22.00 0.00 0.00 1.1175 0.0000 643246.33 945633.04 31.98 26165.24 26165.24
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 18.66 84.82% 25383.09 21983 26380 25382.89 24781 26136 473661 696326 31.98
crit 3.34 15.18% 50781.38 43967 52760 49441.74 0 52760 169586 249307 31.13
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
pet - lord_of_flames_infernal 116021 / 9823
Immolation 90304 0.7% 1.0 0.00sec 2257683 0 Periodic 46.3 42455 84897 48805 15.0% 8.2%

Stats details: immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 23.13 46.26 0.0000 1.0619 2257683.19 2257683.19 0.00 91925.21 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 39.3 85.04% 42454.65 36761 44114 42452.55 41383 43589 1670040 1670040 0.00
crit 6.9 14.96% 84897.32 73523 88227 84860.26 0 88227 587643 587643 0.00
 
 

Action details: immolation

Static Values
  • id:19483
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!ticking
Spelldata
  • id:19483
  • name:Immolation
  • school:fire
  • tooltip:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
 

Action details: immolation_tick

Static Values
  • id:20153
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all enemies near the caster.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
melee 25718 0.2% 22.0 1.12sec 29226 26154 Direct 22.0 25385 50760 29225 15.1%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.00 22.00 0.00 0.00 1.1175 0.0000 642970.19 945227.09 31.98 26154.01 26154.01
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 18.67 84.86% 25385.01 21983 26380 25384.90 24689 26380 473937 696732 31.98
crit 3.33 15.14% 50759.98 43967 52760 49506.52 0 52760 169033 248495 31.19
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
pet - shadowy_tear 121199 / 20720
Shadow Bolt 121199 2.0% 4.4 59.00sec 1403768 0 Periodic 48.4 111267 222674 128055 15.1% 20.0%

Stats details: shadow_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.42 0.00 48.67 48.40 0.0000 1.2345 6198064.94 6198064.94 0.00 103154.95 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 41.1 84.93% 111267.46 71 135736 111019.23 0 135736 4574161 4574161 0.00
crit 7.3 15.07% 222673.74 141 271471 219660.41 0 271471 1623904 1623904 0.00
 
 

Action details: shadow_bolt

Static Values
  • id:196657
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:196657
  • name:Shadow Bolt
  • school:shadow
  • tooltip:
  • description:Sends a shadowy bolt at the enemy, causing {$s1=1} Shadow damage.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:14.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
pet - chaos_tear 139872 / 9770
Chaos Bolt 139872 1.0% 4.4 59.44sec 663248 329797 Direct 4.4 0 667323 667323 100.0%  

Stats details: chaos_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.41 4.39 0.00 0.00 2.0112 0.0000 2926288.67 2926288.67 0.00 329796.99 329796.99
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 4.39 100.00% 667322.58 618855 781036 668131.65 618855 781036 2926289 2926289 0.00
 
 

Action details: chaos_bolt

Static Values
  • id:215279
  • school:chromatic
  • resource:none
  • range:100.0
  • travel_speed:16.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:5.500
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:215279
  • name:Chaos Bolt
  • school:chromatic
  • tooltip:
  • description:Unleashes a devastating blast of chaos, causing {$s1=1} Chaos damage. Chaos Bolt always critically strikes and your critical strike chance increases its damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:5.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
pet - chaos_portal 247680 / 18638
Chaos Barrage 247680 1.8% 4.4 59.32sec 1268442 0 Periodic 151.1 32047 64116 36876 15.1% 7.9%

Stats details: chaos_barrage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.39 0.00 151.86 151.09 0.0000 0.1571 5571636.48 5571636.48 0.00 233601.80 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 128.3 84.94% 32047.08 259 37328 31981.71 0 37328 4112845 4112845 0.00
crit 22.8 15.06% 64116.30 519 74656 63933.59 0 74656 1458792 1458792 0.00
 
 

Action details: chaos_barrage

Static Values
  • id:187394
  • school:magic
  • resource:none
  • range:100.0
  • travel_speed:24.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:187394
  • name:Chaos Barrage
  • school:magic
  • tooltip:
  • description:Deals {$s1=1} Chaos damage.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:5.50
  • base_tick_time:0.25
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Simple Action Stats Execute Interval
KJ_Trinket
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:KJ_Trinket
  • harmful:false
  • if_expr:
 
Berserking 2.1 180.45sec

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.08 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=15}%.
  • description:Increases your haste by {$s1=15}% for {$d=10 seconds}.
 
Dimensional Rift 13.1 23.33sec

Stats details: dimensional_rift

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.14 0.00 0.00 0.00 1.0213 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: dimensional_rift

Static Values
  • id:196586
  • school:none
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:45.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:charges=3
Spelldata
  • id:196586
  • name:Dimensional Rift
  • school:chaos
  • tooltip:
  • description:Rips a hole in time and space, opening a portal that damages your target.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:KJ_Trinket
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:KJ_Trinket
  • harmful:false
  • if_expr:
 
Havoc 14.9 20.94sec

Stats details: havoc

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.88 0.00 0.00 0.00 1.0799 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: havoc

Static Values
  • id:80240
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:88000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies>1&(active_enemies<4|talent.wreak_havoc.enabled&active_enemies<6)&!debuff.havoc.remains
Spelldata
  • id:80240
  • name:Havoc
  • school:shadow
  • tooltip:Spells cast by the Warlock also hit this target.
  • description:Marks a target with Havoc for {$d=8 seconds}, causing your single target spells to also strike the Havoc victim. Limit 1.
 
Life Tap 7.5 30.68sec

Stats details: life_tap

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.50 0.00 0.00 0.00 1.0620 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: life_tap

Static Values
  • id:1454
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.empowered_life_tap.enabled&!buff.empowered_life_tap.remains
Spelldata
  • id:1454
  • name:Life Tap
  • school:shadow
  • tooltip:
  • description:Restores {$s1=30}% of your maximum mana, at the cost of {$s2=10}% of your maximum health.
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Grimoire: Imp (service_imp) 3.7 91.84sec

Stats details: service_imp

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.68 0.00 0.00 0.00 0.9841 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: service_imp

Static Values
  • id:111859
  • school:shadow
  • resource:soul_shard
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:90.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:111859
  • name:Grimoire: Imp
  • school:shadow
  • tooltip:
  • description:Summons an Imp who attacks the target for {$108501s1=25} sec. Imps cast ranged Firebolts and cleanse a hostile magic effect from their master.
 
Soul Harvest 2.9 120.90sec

Stats details: soul_harvest

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.90 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: soul_harvest

Static Values
  • id:196098
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:196098
  • name:Soul Harvest
  • school:shadow
  • tooltip:Damage increased by {$s1=20}%.
  • description:Increases your damage and your pets' damage by {$s1=20}%. Lasts {$d=15 seconds}, increased by {$s2=2} sec for each target afflicted by your {$?s137043=false}[Agony][]{$?s137044=false}[Doom][]{$?s137046=false}[Immolate][], up to a maximum of {$s3=35} sec.
 
Summon Doomguard 1.0 0.00sec

Stats details: summon_doomguard

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 1.0933 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_doomguard

Static Values
  • id:18540
  • school:shadow
  • resource:soul_shard
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.grimoire_of_supremacy.enabled&active_enemies=1&artifact.lord_of_flames.rank=0
Spelldata
  • id:18540
  • name:Summon Doomguard
  • school:shadow
  • tooltip:
  • description:Summons a Doomguard for {$60478d=25 seconds} to assault the target with its Doom Bolts.
 
Summon Imp 1.0 0.00sec

Stats details: summon_imp

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_imp

Static Values
  • id:688
  • school:shadow
  • resource:soul_shard
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!talent.grimoire_of_supremacy.enabled&(!talent.grimoire_of_sacrifice.enabled|buff.demonic_power.down)
Spelldata
  • id:688
  • name:Summon Imp
  • school:shadow
  • tooltip:
  • description:Summons an Imp under your command that casts ranged Firebolts.$?s74434[ |cFFFFFFFFSoulburn:|r |cFF8282FFInstant cast.|r][]
 
Summon Infernal 1.0 0.00sec

Stats details: summon_infernal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.7653 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_infernal

Static Values
  • id:1122
  • school:shadow
  • resource:soul_shard
  • range:30.0
  • travel_speed:1.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.grimoire_of_supremacy.enabled&artifact.lord_of_flames.rank>0
Spelldata
  • id:1122
  • name:Summon Infernal
  • school:shadow
  • tooltip:
  • description:Summons an Infernal from the Twisting Nether, impacting for {$22703s1=0} Fire damage and stunning all enemy targets in the area for {$22703d=2 seconds}. The Infernal will serve you for {$111685d=25 seconds}, dealing strong area-of-effect damage.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Berserking 2.1 0.0 180.4sec 180.4sec 6.87% 20.63% 0.0(0.0) 2.0

Buff details

  • buff initial source:KJ_Trinket
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:10.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • berserking_1:6.87%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=15}%.
  • description:Increases your haste by {$s1=15}% for {$d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.55% 38.73% 0.0(0.0) 1.0

Buff details

  • buff initial source:KJ_Trinket
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:13.55%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Conflagration of Chaos 23.9 0.0 12.4sec 12.4sec 49.19% 46.47% 0.0(0.0) 1.2

Buff details

  • buff initial source:KJ_Trinket
  • cooldown name:buff_conflagration_of_chaos
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:50.00%
  • default_value:-0.00

Stack Uptimes

  • conflagration_of_chaos_1:49.19%

Trigger Attempt Success

  • trigger_pct:50.00%

Spelldata details

  • id:196546
  • name:Conflagration of Chaos
  • tooltip:Your {$?s17877=false}[Shadowburn][Conflagrate] will always critically strike. Critical strike chance will increase the critical strike damage of {$?s17877=false}[Shadowburn][Conflagrate].
  • description:{$@spelldesc219195={$?s17877=false}[Shadowburn][Conflagrate] has a chance to guarantee your next {$?s17877=false}[Shadowburn][Conflagrate] critically strikes, and to increase its damage by your critical strike chance.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Devil's Due 3.5 0.0 69.5sec 69.5sec 8.72% 21.07% 0.0(0.0) 3.2

Buff details

  • buff initial source:KJ_Trinket
  • cooldown name:buff_devils_due
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.18

Stack Uptimes

  • devils_due_1:8.72%

Trigger Attempt Success

  • trigger_pct:99.94%

Spelldata details

  • id:225776
  • name:Devil's Due
  • tooltip:Cast speed slowed by {$s1=7}%.
  • description:{$@spelldesc225142=Your damaging spells have a chance to grant Nefarious Pact, increasing your casting speed by {$225774s1=17}% for {$225774d=12 seconds}. When Nefarious Pact expires, your casting speed is decreased by {$225776s1=7}% for {$225776d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Embrace Chaos 26.2 31.6 11.7sec 5.1sec 58.74% 66.22% 31.6(31.6) 25.5

Buff details

  • buff initial source:KJ_Trinket
  • cooldown name:buff_embrace_chaos
  • max_stacks:1
  • duration:4.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • embrace_chaos_1:58.74%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:212019
  • name:Embrace Chaos
  • tooltip:Chaos Bolt has {$s1=40}% reduced cast time.
  • description:{$@spelldesc212018=Casting Chaos Bolt reduces the cast time of your next Chaos Bolt by {$212019s1=40}% for {$212019d=4 seconds}.}
  • max_stacks:0
  • duration:4.00
  • cooldown:0.00
  • default_chance:0.00%
Lord of Flames 1.0 0.0 0.0sec 0.0sec 97.86% 97.86% 0.0(0.0) 0.0

Buff details

  • buff initial source:KJ_Trinket
  • cooldown name:buff_lord_of_flames
  • max_stacks:1
  • duration:600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • lord_of_flames_1:97.86%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:226802
  • name:Lord of Flames
  • tooltip:Recently activated Lord of Flames.
  • description:{$@spelldesc224103=Once every {$s2=10} minutes, {$?s152107=false}[your Infernal's Meteor Strike][Summon Infernal] will summon {$s3=3} additional Infernals to serve you for {$226804d=25 seconds}.}
  • max_stacks:0
  • duration:600.00
  • cooldown:0.00
  • default_chance:0.00%
Nefarious Pact 3.5 0.0 69.8sec 69.1sec 13.56% 23.76% 0.0(0.0) 3.3

Buff details

  • buff initial source:KJ_Trinket
  • cooldown name:buff_nefarious_pact
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.44

Stack Uptimes

  • nefarious_pact_1:13.56%

Trigger Attempt Success

  • trigger_pct:99.94%

Spelldata details

  • id:225774
  • name:Nefarious Pact
  • tooltip:Cast speed increased by {$s1=17}%.
  • description:{$@spelldesc225142=Your damaging spells have a chance to grant Nefarious Pact, increasing your casting speed by {$225774s1=17}% for {$225774d=12 seconds}. When Nefarious Pact expires, your casting speed is decreased by {$225776s1=7}% for {$225776d=8 seconds}.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of Deadly Grace 1.0 0.0 0.0sec 0.0sec 10.16% 10.16% 0.0(0.0) 1.0

Buff details

  • buff initial source:KJ_Trinket
  • cooldown name:buff_potion_of_deadly_grace
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_deadly_grace_1:10.16%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188027
  • name:Potion of Deadly Grace
  • tooltip:Your attacks have a chance to unleash a bolt of energy at your target.
  • description:Grants your attacks a chance to unleash a bolt of energy at your target. Staying away from enemies for the entire duration of the effect will extend the effect by an additional 5 seconds.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
Potion of Prolonged Power 1.0 0.0 0.0sec 0.0sec 19.64% 19.64% 0.0(0.0) 1.0

Buff details

  • buff initial source:KJ_Trinket
  • cooldown name:buff_potion_of_prolonged_power
  • max_stacks:1
  • duration:60.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:all
  • amount:2500.00

Stack Uptimes

  • potion_of_prolonged_power_1:19.64%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:229206
  • name:Potion of Prolonged Power
  • tooltip:All stats increased by {$s1=2500}.
  • description:Drink to increase all stats by {$s1=2500} for {$d=60 seconds}.
  • max_stacks:0
  • duration:60.00
  • cooldown:1.00
  • default_chance:0.00%
Soul Harvest 2.9 0.0 120.9sec 120.9sec 17.76% 17.76% 0.0(0.0) 2.7

Buff details

  • buff initial source:KJ_Trinket
  • cooldown name:buff_soul_harvest
  • max_stacks:1
  • duration:15.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • soul_harvest_1:17.76%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:196098
  • name:Soul Harvest
  • tooltip:Damage increased by {$s1=20}%.
  • description:Increases your damage and your pets' damage by {$s1=20}%. Lasts {$d=15 seconds}, increased by {$s2=2} sec for each target afflicted by your {$?s137043=false}[Agony][]{$?s137044=false}[Doom][]{$?s137046=false}[Immolate][], up to a maximum of {$s3=35} sec.
  • max_stacks:0
  • duration:15.00
  • cooldown:120.00
  • default_chance:0.00%
Constant Buffs
Well Fed (azshari_salad)

Buff details

  • buff initial source:KJ_Trinket
  • cooldown name:buff_azshari_salad
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:375.00

Stack Uptimes

  • azshari_salad_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225603
  • name:Well Fed
  • tooltip:Haste increased by $w1.
  • description:Increases haste by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Defiled Augmentation

Buff details

  • buff initial source:KJ_Trinket
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Whispered Pact

Buff details

  • buff initial source:KJ_Trinket
  • cooldown name:buff_flask_of_the_whispered_pact
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:1300.00

Stack Uptimes

  • flask_of_the_whispered_pact_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188031
  • name:Flask of the Whispered Pact
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%

Procs

Count Interval
shadowy_tear 4.4 59.0sec
chaos_tear 4.4 58.6sec
chaos_portal 4.3 59.0sec
dimension_ripper 4.0 54.3sec

Resources

Resource Usage Type Count Total Average RPE APR
KJ_Trinket
chaos_bolt Soul Shard 57.8 115.5 2.0 2.0 833110.7
havoc Mana 14.9 1309038.5 88000.0 88000.3 0.0
immolate Mana 19.8 1305194.0 66000.0 66000.0 54.6
incinerate Mana 79.0 5216144.4 66000.0 65998.7 7.7
service_imp Soul Shard 3.7 3.7 1.0 1.0 0.0
summon_doomguard Soul Shard 1.0 1.0 1.0 1.0 0.0
summon_infernal Soul Shard 1.0 1.0 1.0 1.0 0.0
pet - imp
firebolt Energy 107.6 4304.4 40.0 40.0 2947.9
pet - service_imp
firebolt Energy 48.1 1925.4 40.0 40.0 6026.9
pet - doomguard
doom_bolt Energy 10.5 368.9 35.0 35.0 6278.5
Resource Gains Type Count Total Average Overflow
life_tap Mana 7.50 2474356.69 (35.52%) 330000.00 0.00 0.00%
immolate Soul Shard 63.88 63.35 (52.85%) 0.99 0.53 0.83%
conflagrate Soul Shard 47.90 47.85 (39.92%) 1.00 0.05 0.11%
mp5_regen Mana 424.29 4491961.67 (64.48%) 10586.95 85998.14 1.88%
soulsnatcher Soul Shard 8.67 8.67 (7.23%) 1.00 0.00 0.00%
pet - imp
energy_regen Energy 1899.76 4138.19 (100.00%) 2.18 21.48 0.52%
pet - service_imp
energy_regen Energy 437.34 1313.60 (100.00%) 3.00 61.65 4.48%
pet - doomguard
energy_regen Energy 15.43 327.90 (100.00%) 21.25 42.34 11.44%
Resource RPS-Gain RPS-Loss
Health 0.00 7698.31
Mana 23134.89 26004.32
Soul Shard 0.40 0.40
Combat End Resource Mean Min Max
Mana 235070.21 5794.95 567926.92
Soul Shard 1.65 0.00 5.00

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 1.3%

Statistics & Data Analysis

Fight Length
Sample Data KJ_Trinket Fight Length
Count 9999
Mean 301.12
Minimum 221.26
Maximum 379.15
Spread ( max - min ) 157.89
Range [ ( max - min ) / 2 * 100% ] 26.22%
DPS
Sample Data KJ_Trinket Damage Per Second
Count 9999
Mean 1015237.83
Minimum 884266.25
Maximum 1160334.35
Spread ( max - min ) 276068.09
Range [ ( max - min ) / 2 * 100% ] 13.60%
Priority Target DPS
Sample Data KJ_Trinket Priority Target Damage Per Second
Count 9999
Mean 593844.44
Minimum 517619.09
Maximum 680337.17
Spread ( max - min ) 162718.08
Range [ ( max - min ) / 2 * 100% ] 13.70%
DPS(e)
Sample Data KJ_Trinket Damage Per Second (Effective)
Count 9999
Mean 1015237.83
Minimum 884266.25
Maximum 1160334.35
Spread ( max - min ) 276068.09
Range [ ( max - min ) / 2 * 100% ] 13.60%
Damage
Sample Data KJ_Trinket Damage
Count 9999
Mean 251991336.39
Minimum 180046123.82
Maximum 337380523.67
Spread ( max - min ) 157334399.84
Range [ ( max - min ) / 2 * 100% ] 31.22%
DTPS
Sample Data KJ_Trinket Damage Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data KJ_Trinket Healing Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS(e)
Sample Data KJ_Trinket Healing Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data KJ_Trinket Heal
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data KJ_Trinket Healing Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data KJ_Trinket Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
ETMI
Sample Data KJ_TrinketTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data KJ_Trinket Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=whispered_pact
1 0.00 food,type=azshari_salad
2 0.00 summon_pet,if=!talent.grimoire_of_supremacy.enabled&(!talent.grimoire_of_sacrifice.enabled|buff.demonic_power.down)
3 0.00 summon_infernal,if=talent.grimoire_of_supremacy.enabled&artifact.lord_of_flames.rank>0
4 0.00 summon_infernal,if=talent.grimoire_of_supremacy.enabled&active_enemies>1
5 0.00 summon_doomguard,if=talent.grimoire_of_supremacy.enabled&active_enemies=1&artifact.lord_of_flames.rank=0
6 0.00 augmentation,type=defiled
7 0.00 snapshot_stats
8 0.00 grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
9 0.00 life_tap,if=talent.empowered_life_tap.enabled&!buff.empowered_life_tap.remains
A 0.00 potion,name=prolonged_power
B 0.00 chaos_bolt
Default action list Executed every time the actor is available.
# count action,conditions
C 4.48 use_item,name=kiljaedens_burning_wish
D 14.88 havoc,target=2,if=active_enemies>1&(active_enemies<4|talent.wreak_havoc.enabled&active_enemies<6)&!debuff.havoc.remains
E 1.00 dimensional_rift,if=charges=3
F 10.26 immolate,if=remains<=tick_time
G 0.61 immolate,cycle_targets=1,if=active_enemies>1&remains<=tick_time&(!talent.roaring_blaze.enabled|(!debuff.roaring_blaze.remains&action.conflagrate.charges<2))
H 8.95 immolate,if=talent.roaring_blaze.enabled&remains<=duration&!debuff.roaring_blaze.remains&target.time_to_die>10&(action.conflagrate.charges=2+set_bonus.tier19_4pc|(action.conflagrate.charges>=1+set_bonus.tier19_4pc&action.conflagrate.recharge_time<cast_time+gcd)|target.time_to_die<24)
I 2.08 berserking
0.00 blood_fury
0.00 arcane_torrent
J 1.00 potion,name=deadly_grace,if=(buff.soul_harvest.remains|trinket.proc.any.react|target.time_to_die<=45)
0.00 shadowburn,if=buff.conflagration_of_chaos.remains<=action.chaos_bolt.cast_time
0.00 shadowburn,if=(charges=1&recharge_time<action.chaos_bolt.cast_time|charges=2)&soul_shard<5
K 13.78 conflagrate,if=talent.roaring_blaze.enabled&(charges=2+set_bonus.tier19_4pc|(charges>=1+set_bonus.tier19_4pc&recharge_time<gcd)|target.time_to_die<24)
L 34.13 conflagrate,if=talent.roaring_blaze.enabled&debuff.roaring_blaze.stack>0&dot.immolate.remains>dot.immolate.duration*0.3&(active_enemies=1|soul_shard<3)&soul_shard<5
0.00 conflagrate,if=!talent.roaring_blaze.enabled&!buff.backdraft.remains&buff.conflagration_of_chaos.remains<=action.chaos_bolt.cast_time
0.00 conflagrate,if=!talent.roaring_blaze.enabled&!buff.backdraft.remains&(charges=1&recharge_time<action.chaos_bolt.cast_time|charges=2)&soul_shard<5
0.00 life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<=gcd
0.00 dimensional_rift,if=equipped.144369&!buff.lessons_of_spacetime.remains&((!talent.grimoire_of_supremacy.enabled&!cooldown.summon_doomguard.remains)|(talent.grimoire_of_service.enabled&!cooldown.service_pet.remains)|(talent.soul_harvest.enabled&!cooldown.soul_harvest.remains))
M 3.68 service_pet
N 1.00 summon_infernal,if=artifact.lord_of_flames.rank>0&!buff.lord_of_flames.remains
O 1.00 summon_doomguard,if=!talent.grimoire_of_supremacy.enabled&spell_targets.infernal_awakening<=2&(target.time_to_die>180|target.health.pct<=20|target.time_to_die<30)
0.00 summon_infernal,if=!talent.grimoire_of_supremacy.enabled&spell_targets.infernal_awakening>2
0.00 summon_doomguard,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal=1&artifact.lord_of_flames.rank>0&buff.lord_of_flames.remains&!pet.doomguard.active
0.00 summon_doomguard,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal=1&equipped.132379&!cooldown.sindorei_spite_icd.remains
0.00 summon_infernal,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal>1&equipped.132379&!cooldown.sindorei_spite_icd.remains
P 2.90 soul_harvest
0.00 channel_demonfire,if=dot.immolate.remains>cast_time
0.00 havoc,if=active_enemies=1&talent.wreak_havoc.enabled&equipped.132375&!debuff.havoc.remains
0.00 rain_of_fire,if=active_enemies>=3&cooldown.havoc.remains<=12&!talent.wreak_havoc.enabled
0.00 rain_of_fire,if=active_enemies>=6&talent.wreak_havoc.enabled
Q 12.14 dimensional_rift,if=!equipped.144369|charges>1|((!talent.grimoire_of_service.enabled|recharge_time<cooldown.service_pet.remains)&(!talent.soul_harvest.enabled|recharge_time<cooldown.soul_harvest.remains)&(!talent.grimoire_of_supremacy.enabled|recharge_time<cooldown.summon_doomguard.remains))
0.00 life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<duration*0.3
0.00 cataclysm
R 57.08 chaos_bolt,if=(cooldown.havoc.remains>12&cooldown.havoc.remains|active_enemies<3|talent.wreak_havoc.enabled&active_enemies<6)
0.00 shadowburn
0.00 conflagrate,if=!talent.roaring_blaze.enabled&!buff.backdraft.remains
0.00 immolate,if=!talent.roaring_blaze.enabled&remains<=duration*0.3
S 79.37 incinerate
T 7.50 life_tap

Sample Sequence

0126ABCDEFHIKLMLNPQLQRRSSLRRSSLRDRSSFSRRSSHKLRLRSLRDSSLQRRSRSFSRSSDSHKLLRRSSRLSSCRSSLDQRFRSTQSSMSHKRDLRLLRRSSLRRSSFSDTRPJSSRHKRLLQRSLRDSSLSCSSSTFSSSSSRDHKLLRRLSRSQLIRRSMDTRSSFSSRSSTHKRLRLDRLRSLRSSSSFRSCQDSSTHKLOLRRLSRSPSDLRSQFRSSSSSTHKLDQRLRKMSSKRSQSFDGKRKRSS

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask KJ_Trinket 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 1 food KJ_Trinket 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 2 summon_imp Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 6 augmentation KJ_Trinket 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat A potion Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard potion_of_prolonged_power
0:00.000 precombat B chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard embrace_chaos, nefarious_pact, potion_of_prolonged_power
0:00.000 default C use_item_kiljaedens_burning_wish Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard embrace_chaos, nefarious_pact, potion_of_prolonged_power
0:00.000 default D havoc enemy2 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard embrace_chaos, nefarious_pact, potion_of_prolonged_power
0:00.795 default E dimensional_rift Fluffy_Pillow 1023490.7/1100000: 93% mana | 1.0/5: 20% soul_shard embrace_chaos, nefarious_pact, potion_of_prolonged_power
0:01.590 default F immolate Fluffy_Pillow 1038428.6/1100000: 94% mana | 1.0/5: 20% soul_shard bloodlust, embrace_chaos, nefarious_pact, potion_of_prolonged_power
0:02.344 default H immolate Fluffy_Pillow 986596.1/1100000: 90% mana | 1.0/5: 20% soul_shard bloodlust, embrace_chaos, nefarious_pact, potion_of_prolonged_power
0:03.097 default I berserking Fluffy_Pillow 934744.9/1100000: 85% mana | 1.0/5: 20% soul_shard bloodlust, embrace_chaos, nefarious_pact, potion_of_prolonged_power
0:03.097 default K conflagrate Fluffy_Pillow 934744.9/1100000: 85% mana | 1.0/5: 20% soul_shard bloodlust, berserking, embrace_chaos, nefarious_pact, potion_of_prolonged_power
0:03.851 default L conflagrate Fluffy_Pillow 951037.5/1100000: 86% mana | 2.0/5: 40% soul_shard bloodlust, berserking, conflagration_of_chaos, embrace_chaos, nefarious_pact, potion_of_prolonged_power
0:04.605 default M service_imp Fluffy_Pillow 967330.2/1100000: 88% mana | 3.0/5: 60% soul_shard bloodlust, berserking, nefarious_pact, potion_of_prolonged_power
0:05.359 default L conflagrate Fluffy_Pillow 983622.8/1100000: 89% mana | 2.0/5: 40% soul_shard bloodlust, berserking, nefarious_pact, potion_of_prolonged_power
0:06.112 default N summon_infernal Fluffy_Pillow 999893.9/1100000: 91% mana | 3.0/5: 60% soul_shard bloodlust, berserking, nefarious_pact, potion_of_prolonged_power
0:06.868 default P soul_harvest Fluffy_Pillow 1016229.7/1100000: 92% mana | 2.0/5: 40% soul_shard bloodlust, berserking, lord_of_flames, nefarious_pact, potion_of_prolonged_power
0:06.868 default Q dimensional_rift Fluffy_Pillow 1016229.7/1100000: 92% mana | 2.0/5: 40% soul_shard bloodlust, berserking, soul_harvest, lord_of_flames, nefarious_pact, potion_of_prolonged_power
0:07.622 default L conflagrate Fluffy_Pillow 1032522.4/1100000: 94% mana | 2.0/5: 40% soul_shard bloodlust, berserking, soul_harvest, lord_of_flames, nefarious_pact, potion_of_prolonged_power
0:08.433 default Q dimensional_rift Fluffy_Pillow 1050046.7/1100000: 95% mana | 4.0/5: 80% soul_shard bloodlust, berserking, soul_harvest, lord_of_flames, conflagration_of_chaos, nefarious_pact, potion_of_prolonged_power
0:09.187 default R chaos_bolt Fluffy_Pillow 1066339.4/1100000: 97% mana | 4.0/5: 80% soul_shard bloodlust, berserking, soul_harvest, lord_of_flames, conflagration_of_chaos, nefarious_pact, potion_of_prolonged_power
0:10.248 default R chaos_bolt Fluffy_Pillow 1089265.8/1100000: 99% mana | 3.0/5: 60% soul_shard bloodlust, berserking, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, potion_of_prolonged_power
0:11.002 default S incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard bloodlust, berserking, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, potion_of_prolonged_power
0:11.755 default S incinerate Fluffy_Pillow 1036571.4/1100000: 94% mana | 1.0/5: 20% soul_shard bloodlust, berserking, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, potion_of_prolonged_power
0:12.509 default L conflagrate Fluffy_Pillow 986864.0/1100000: 90% mana | 2.0/5: 40% soul_shard bloodlust, berserking, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due, potion_of_prolonged_power
0:13.412 default R chaos_bolt Fluffy_Pillow 1005488.5/1100000: 91% mana | 4.0/5: 80% soul_shard bloodlust, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due, potion_of_prolonged_power
0:14.658 default R chaos_bolt Fluffy_Pillow 1028900.6/1100000: 94% mana | 2.0/5: 40% soul_shard bloodlust, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due, potion_of_prolonged_power
0:15.904 default S incinerate Fluffy_Pillow 1052312.7/1100000: 96% mana | 1.0/5: 20% soul_shard bloodlust, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due, potion_of_prolonged_power
0:17.149 default S incinerate Fluffy_Pillow 1009706.1/1100000: 92% mana | 1.0/5: 20% soul_shard bloodlust, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due, potion_of_prolonged_power
0:18.396 default L conflagrate Fluffy_Pillow 967137.0/1100000: 88% mana | 1.0/5: 20% soul_shard bloodlust, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due, potion_of_prolonged_power
0:19.435 default R chaos_bolt Fluffy_Pillow 986659.6/1100000: 90% mana | 2.0/5: 40% soul_shard bloodlust, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due, potion_of_prolonged_power
0:20.682 default D havoc enemy2 1010090.5/1100000: 92% mana | 1.0/5: 20% soul_shard bloodlust, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, potion_of_prolonged_power
0:21.564 default R chaos_bolt Fluffy_Pillow 938663.1/1100000: 85% mana | 2.0/5: 40% soul_shard bloodlust, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, potion_of_prolonged_power
0:22.622 default S incinerate Fluffy_Pillow 958542.7/1100000: 87% mana | 1.0/5: 20% soul_shard bloodlust, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, potion_of_prolonged_power
0:23.680 default S incinerate Fluffy_Pillow 912422.4/1100000: 83% mana | 1.0/5: 20% soul_shard bloodlust, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, potion_of_prolonged_power
0:24.738 default F immolate Fluffy_Pillow 866302.0/1100000: 79% mana | 1.0/5: 20% soul_shard bloodlust, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, potion_of_prolonged_power
0:25.621 default S incinerate Fluffy_Pillow 816893.4/1100000: 74% mana | 1.0/5: 20% soul_shard bloodlust, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, potion_of_prolonged_power
0:26.679 default R chaos_bolt Fluffy_Pillow 770773.0/1100000: 70% mana | 2.0/5: 40% soul_shard bloodlust, lord_of_flames, conflagration_of_chaos, potion_of_prolonged_power
0:28.442 default R chaos_bolt Fluffy_Pillow 803899.5/1100000: 73% mana | 2.0/5: 40% soul_shard bloodlust, lord_of_flames, conflagration_of_chaos, embrace_chaos, potion_of_prolonged_power
0:29.500 default S incinerate Fluffy_Pillow 823779.1/1100000: 75% mana | 0.0/5: 0% soul_shard bloodlust, lord_of_flames, conflagration_of_chaos, embrace_chaos, potion_of_prolonged_power
0:30.557 default S incinerate Fluffy_Pillow 777639.9/1100000: 71% mana | 0.0/5: 0% soul_shard bloodlust, lord_of_flames, conflagration_of_chaos, embrace_chaos, potion_of_prolonged_power
0:31.614 default H immolate Fluffy_Pillow 731500.8/1100000: 67% mana | 0.0/5: 0% soul_shard bloodlust, lord_of_flames, conflagration_of_chaos, embrace_chaos, potion_of_prolonged_power
0:32.496 default K conflagrate Fluffy_Pillow 682073.4/1100000: 62% mana | 0.0/5: 0% soul_shard bloodlust, lord_of_flames, conflagration_of_chaos, embrace_chaos, potion_of_prolonged_power
0:33.378 default L conflagrate Fluffy_Pillow 698646.0/1100000: 64% mana | 2.0/5: 40% soul_shard bloodlust, lord_of_flames, conflagration_of_chaos, embrace_chaos, potion_of_prolonged_power
0:34.261 default R chaos_bolt Fluffy_Pillow 715237.4/1100000: 65% mana | 3.0/5: 60% soul_shard bloodlust, lord_of_flames, potion_of_prolonged_power
0:36.021 default L conflagrate Fluffy_Pillow 748307.5/1100000: 68% mana | 1.0/5: 20% soul_shard bloodlust, lord_of_flames, embrace_chaos, potion_of_prolonged_power
0:36.905 default R chaos_bolt Fluffy_Pillow 764917.7/1100000: 70% mana | 3.0/5: 60% soul_shard bloodlust, lord_of_flames, conflagration_of_chaos, embrace_chaos, potion_of_prolonged_power
0:37.962 default S incinerate Fluffy_Pillow 784778.6/1100000: 71% mana | 1.0/5: 20% soul_shard bloodlust, lord_of_flames, conflagration_of_chaos, embrace_chaos, potion_of_prolonged_power
0:39.018 default L conflagrate Fluffy_Pillow 738620.6/1100000: 67% mana | 2.0/5: 40% soul_shard bloodlust, lord_of_flames, conflagration_of_chaos, embrace_chaos, potion_of_prolonged_power
0:39.900 default R chaos_bolt Fluffy_Pillow 755193.2/1100000: 69% mana | 3.0/5: 60% soul_shard bloodlust, lord_of_flames, embrace_chaos, potion_of_prolonged_power
0:40.957 default D havoc enemy2 775054.1/1100000: 70% mana | 1.0/5: 20% soul_shard bloodlust, lord_of_flames, embrace_chaos, potion_of_prolonged_power
0:41.840 default S incinerate Fluffy_Pillow 699816.7/1100000: 64% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, potion_of_prolonged_power
0:43.214 default S incinerate Fluffy_Pillow 653676.1/1100000: 59% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, potion_of_prolonged_power
0:44.587 default L conflagrate Fluffy_Pillow 607521.0/1100000: 55% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, potion_of_prolonged_power
0:45.733 default Q dimensional_rift Fluffy_Pillow 624085.0/1100000: 57% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, potion_of_prolonged_power
0:46.941 default R chaos_bolt Fluffy_Pillow 641545.0/1100000: 58% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, potion_of_prolonged_power
0:49.229 default R chaos_bolt Fluffy_Pillow 674615.1/1100000: 61% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, potion_of_prolonged_power
0:50.603 default S incinerate Fluffy_Pillow 694474.5/1100000: 63% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, potion_of_prolonged_power
0:51.977 default R chaos_bolt Fluffy_Pillow 648333.9/1100000: 59% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, potion_of_prolonged_power
0:53.351 default S incinerate Fluffy_Pillow 668193.3/1100000: 61% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, potion_of_prolonged_power
0:54.724 default F immolate Fluffy_Pillow 622038.2/1100000: 57% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, potion_of_prolonged_power
0:55.868 default S incinerate Fluffy_Pillow 572573.3/1100000: 52% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, potion_of_prolonged_power
0:57.243 default R chaos_bolt Fluffy_Pillow 526447.1/1100000: 48% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, potion_of_prolonged_power
0:58.617 default S incinerate Fluffy_Pillow 546306.5/1100000: 50% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
0:59.992 default S incinerate Fluffy_Pillow 500180.4/1100000: 45% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
1:01.364 default D havoc enemy2 454010.9/1100000: 41% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
1:02.510 default S incinerate Fluffy_Pillow 382574.8/1100000: 35% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
1:03.883 default H immolate Fluffy_Pillow 336419.7/1100000: 31% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, nefarious_pact
1:04.678 default K conflagrate Fluffy_Pillow 281910.4/1100000: 26% mana | 0.0/5: 0% soul_shard lord_of_flames, nefarious_pact
1:05.472 default L conflagrate Fluffy_Pillow 293386.7/1100000: 27% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, nefarious_pact
1:06.266 default L conflagrate Fluffy_Pillow 304862.9/1100000: 28% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, nefarious_pact
1:07.061 default R chaos_bolt Fluffy_Pillow 316353.6/1100000: 29% mana | 3.0/5: 60% soul_shard lord_of_flames, nefarious_pact
1:08.646 default R chaos_bolt Fluffy_Pillow 339262.7/1100000: 31% mana | 3.0/5: 60% soul_shard lord_of_flames, embrace_chaos, nefarious_pact
1:09.598 default S incinerate Fluffy_Pillow 353022.7/1100000: 32% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, nefarious_pact
1:10.551 default S incinerate Fluffy_Pillow 300797.1/1100000: 27% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, nefarious_pact
1:11.504 default R chaos_bolt Fluffy_Pillow 248571.4/1100000: 23% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, nefarious_pact
1:12.458 default L conflagrate Fluffy_Pillow 262360.3/1100000: 24% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos, nefarious_pact
1:13.253 default S incinerate Fluffy_Pillow 273851.0/1100000: 25% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, nefarious_pact
1:14.206 default S incinerate Fluffy_Pillow 221625.4/1100000: 20% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, nefarious_pact
1:15.160 default C use_item_kiljaedens_burning_wish Fluffy_Pillow 169414.2/1100000: 15% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, devils_due
1:15.160 default R chaos_bolt Fluffy_Pillow 169414.2/1100000: 15% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, devils_due
1:16.780 default S incinerate Fluffy_Pillow 192829.2/1100000: 18% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos, devils_due
1:18.399 default S incinerate Fluffy_Pillow 150229.7/1100000: 14% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos, devils_due
1:20.017 default L conflagrate Fluffy_Pillow 107615.8/1100000: 10% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos, devils_due
1:21.366 default D havoc enemy2 127113.9/1100000: 12% mana | 1.0/5: 20% soul_shard lord_of_flames, devils_due
1:22.715 default Q dimensional_rift Fluffy_Pillow 58611.9/1100000: 5% mana | 2.0/5: 40% soul_shard lord_of_flames, devils_due
1:24.065 default R chaos_bolt Fluffy_Pillow 78124.4/1100000: 7% mana | 3.0/5: 60% soul_shard lord_of_flames
1:26.352 default F immolate Fluffy_Pillow 111180.1/1100000: 10% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos
1:27.496 default R chaos_bolt Fluffy_Pillow 61715.1/1100000: 6% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos
1:28.871 default S incinerate Fluffy_Pillow 81589.0/1100000: 7% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos
1:30.243 default T life_tap Fluffy_Pillow 35419.4/1100000: 3% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos
1:31.388 default Q dimensional_rift Fluffy_Pillow 381968.9/1100000: 35% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos
1:32.533 default S incinerate Fluffy_Pillow 398518.4/1100000: 36% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos
1:33.908 default S incinerate Fluffy_Pillow 352392.3/1100000: 32% mana | 1.0/5: 20% soul_shard lord_of_flames
1:35.281 default M service_imp Fluffy_Pillow 306237.2/1100000: 28% mana | 2.0/5: 40% soul_shard lord_of_flames
1:36.427 default S incinerate Fluffy_Pillow 322801.2/1100000: 29% mana | 1.0/5: 20% soul_shard lord_of_flames
1:37.801 default H immolate Fluffy_Pillow 276660.6/1100000: 25% mana | 2.0/5: 40% soul_shard lord_of_flames
1:38.946 default K conflagrate Fluffy_Pillow 227210.1/1100000: 21% mana | 2.0/5: 40% soul_shard lord_of_flames
1:40.093 default R chaos_bolt Fluffy_Pillow 243788.5/1100000: 22% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos
1:42.380 default D havoc enemy2 276844.1/1100000: 25% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
1:43.526 default L conflagrate Fluffy_Pillow 205408.0/1100000: 19% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
1:44.671 default R chaos_bolt Fluffy_Pillow 221957.5/1100000: 20% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
1:46.044 default L conflagrate Fluffy_Pillow 241802.5/1100000: 22% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
1:47.189 default L conflagrate Fluffy_Pillow 258352.0/1100000: 23% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
1:48.333 default R chaos_bolt Fluffy_Pillow 274887.0/1100000: 25% mana | 3.0/5: 60% soul_shard lord_of_flames, embrace_chaos
1:49.707 default R chaos_bolt Fluffy_Pillow 294746.4/1100000: 27% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos
1:51.081 default S incinerate Fluffy_Pillow 314605.8/1100000: 29% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos
1:52.456 default S incinerate Fluffy_Pillow 268479.6/1100000: 24% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos
1:53.829 default L conflagrate Fluffy_Pillow 222324.6/1100000: 20% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos
1:54.976 default R chaos_bolt Fluffy_Pillow 238903.0/1100000: 22% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
1:56.350 default R chaos_bolt Fluffy_Pillow 258762.4/1100000: 24% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
1:57.722 default S incinerate Fluffy_Pillow 278592.9/1100000: 25% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
1:59.094 default S incinerate Fluffy_Pillow 232423.3/1100000: 21% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
2:00.466 default F immolate Fluffy_Pillow 186253.8/1100000: 17% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
2:01.609 default S incinerate Fluffy_Pillow 136774.4/1100000: 12% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
2:02.982 default D havoc enemy2 90619.4/1100000: 8% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos
2:04.129 default T life_tap Fluffy_Pillow 19197.8/1100000: 2% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos
2:05.275 default R chaos_bolt Fluffy_Pillow 365761.7/1100000: 33% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos
2:07.564 default P soul_harvest Fluffy_Pillow 398846.2/1100000: 36% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
2:07.564 default J potion Fluffy_Pillow 398846.2/1100000: 36% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos
2:07.564 default S incinerate Fluffy_Pillow 398846.2/1100000: 36% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, potion_of_deadly_grace
2:08.939 default S incinerate Fluffy_Pillow 352720.1/1100000: 32% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, potion_of_deadly_grace
2:10.312 default R chaos_bolt Fluffy_Pillow 306565.0/1100000: 28% mana | 2.0/5: 40% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, potion_of_deadly_grace
2:11.685 default H immolate Fluffy_Pillow 326410.0/1100000: 30% mana | 2.0/5: 40% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, potion_of_deadly_grace
2:12.830 default K conflagrate Fluffy_Pillow 276959.5/1100000: 25% mana | 2.0/5: 40% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, potion_of_deadly_grace
2:13.977 default R chaos_bolt Fluffy_Pillow 293537.9/1100000: 27% mana | 3.0/5: 60% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, potion_of_deadly_grace
2:15.352 default L conflagrate Fluffy_Pillow 313411.7/1100000: 28% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, potion_of_deadly_grace
2:16.497 default L conflagrate Fluffy_Pillow 329961.2/1100000: 30% mana | 2.0/5: 40% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, potion_of_deadly_grace
2:17.643 default Q dimensional_rift Fluffy_Pillow 346525.1/1100000: 32% mana | 3.0/5: 60% soul_shard soul_harvest, lord_of_flames, embrace_chaos, potion_of_deadly_grace
2:18.787 default R chaos_bolt Fluffy_Pillow 363060.2/1100000: 33% mana | 3.0/5: 60% soul_shard soul_harvest, lord_of_flames, embrace_chaos, potion_of_deadly_grace
2:20.160 default S incinerate Fluffy_Pillow 382905.1/1100000: 35% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, embrace_chaos, potion_of_deadly_grace
2:21.534 default L conflagrate Fluffy_Pillow 336764.5/1100000: 31% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, embrace_chaos, potion_of_deadly_grace
2:22.678 default R chaos_bolt Fluffy_Pillow 353299.6/1100000: 32% mana | 2.0/5: 40% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, potion_of_deadly_grace
2:24.051 default D havoc enemy2 373144.5/1100000: 34% mana | 0.0/5: 0% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, potion_of_deadly_grace
2:25.198 default S incinerate Fluffy_Pillow 301722.9/1100000: 27% mana | 0.0/5: 0% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, potion_of_deadly_grace
2:26.571 default S incinerate Fluffy_Pillow 255567.8/1100000: 23% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, potion_of_deadly_grace
2:27.945 default L conflagrate Fluffy_Pillow 209427.2/1100000: 19% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, potion_of_deadly_grace
2:29.090 default S incinerate Fluffy_Pillow 225976.7/1100000: 21% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, potion_of_deadly_grace
2:30.463 default C use_item_kiljaedens_burning_wish Fluffy_Pillow 179821.7/1100000: 16% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, potion_of_deadly_grace
2:30.463 default S incinerate Fluffy_Pillow 179821.7/1100000: 16% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, potion_of_deadly_grace
2:31.837 default S incinerate Fluffy_Pillow 133681.1/1100000: 12% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, potion_of_deadly_grace
2:33.210 default S incinerate Fluffy_Pillow 87526.0/1100000: 8% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, potion_of_deadly_grace
2:34.583 default T life_tap Fluffy_Pillow 41370.9/1100000: 4% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, potion_of_deadly_grace
2:35.728 default F immolate Fluffy_Pillow 387920.4/1100000: 35% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, potion_of_deadly_grace
2:36.874 default S incinerate Fluffy_Pillow 338484.4/1100000: 31% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, potion_of_deadly_grace
2:38.245 default S incinerate Fluffy_Pillow 292300.4/1100000: 27% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos
2:39.618 default S incinerate Fluffy_Pillow 246145.3/1100000: 22% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos
2:40.992 default S incinerate Fluffy_Pillow 200004.7/1100000: 18% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos
2:42.367 default S incinerate Fluffy_Pillow 153878.6/1100000: 14% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos
2:43.742 default R chaos_bolt Fluffy_Pillow 107752.4/1100000: 10% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos
2:46.030 default D havoc enemy2 140822.5/1100000: 13% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
2:47.176 default H immolate Fluffy_Pillow 69386.5/1100000: 6% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
2:48.319 default K conflagrate Fluffy_Pillow 19907.1/1100000: 2% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos
2:49.464 default L conflagrate Fluffy_Pillow 36456.5/1100000: 3% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos
2:50.610 default L conflagrate Fluffy_Pillow 53020.5/1100000: 5% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos
2:51.756 default R chaos_bolt Fluffy_Pillow 69584.4/1100000: 6% mana | 3.0/5: 60% soul_shard lord_of_flames
2:54.043 default R chaos_bolt Fluffy_Pillow 102640.1/1100000: 9% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos
2:55.416 default L conflagrate Fluffy_Pillow 122485.0/1100000: 11% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos
2:56.561 default S incinerate Fluffy_Pillow 139034.5/1100000: 13% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
2:57.936 default R chaos_bolt Fluffy_Pillow 92908.3/1100000: 8% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
2:59.309 default S incinerate Fluffy_Pillow 112753.3/1100000: 10% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
3:00.680 default Q dimensional_rift Fluffy_Pillow 66569.3/1100000: 6% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
3:01.942 default L conflagrate Fluffy_Pillow 84809.9/1100000: 8% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
3:03.162 default I berserking Fluffy_Pillow 102443.4/1100000: 9% mana | 3.0/5: 60% soul_shard lord_of_flames, embrace_chaos
3:03.162 default R chaos_bolt Fluffy_Pillow 102443.4/1100000: 9% mana | 3.0/5: 60% soul_shard berserking, lord_of_flames, embrace_chaos
3:04.355 default R chaos_bolt Fluffy_Pillow 122273.2/1100000: 11% mana | 2.0/5: 40% soul_shard berserking, lord_of_flames, embrace_chaos, nefarious_pact
3:05.184 default S incinerate Fluffy_Pillow 136052.6/1100000: 12% mana | 0.0/5: 0% soul_shard berserking, lord_of_flames, embrace_chaos, nefarious_pact
3:06.013 default M service_imp Fluffy_Pillow 83832.1/1100000: 8% mana | 1.0/5: 20% soul_shard berserking, lord_of_flames, embrace_chaos, nefarious_pact
3:06.768 default D havoc enemy2 96381.5/1100000: 9% mana | 1.0/5: 20% soul_shard berserking, lord_of_flames, embrace_chaos, nefarious_pact
3:07.522 default T life_tap Fluffy_Pillow 20914.3/1100000: 2% mana | 1.0/5: 20% soul_shard berserking, lord_of_flames, embrace_chaos, nefarious_pact
3:08.278 default R chaos_bolt Fluffy_Pillow 363480.4/1100000: 33% mana | 2.0/5: 40% soul_shard berserking, lord_of_flames, embrace_chaos, nefarious_pact
3:09.106 default S incinerate Fluffy_Pillow 377243.2/1100000: 34% mana | 1.0/5: 20% soul_shard berserking, lord_of_flames, embrace_chaos, nefarious_pact
3:09.935 default S incinerate Fluffy_Pillow 325022.6/1100000: 30% mana | 1.0/5: 20% soul_shard berserking, lord_of_flames, embrace_chaos, nefarious_pact
3:10.764 default F immolate Fluffy_Pillow 272802.1/1100000: 25% mana | 1.0/5: 20% soul_shard berserking, lord_of_flames, embrace_chaos, nefarious_pact
3:11.520 default S incinerate Fluffy_Pillow 219368.1/1100000: 20% mana | 1.0/5: 20% soul_shard berserking, lord_of_flames, embrace_chaos, nefarious_pact
3:12.350 default S incinerate Fluffy_Pillow 167164.2/1100000: 15% mana | 1.0/5: 20% soul_shard berserking, lord_of_flames, embrace_chaos, nefarious_pact
3:13.178 default R chaos_bolt Fluffy_Pillow 114892.3/1100000: 10% mana | 2.0/5: 40% soul_shard lord_of_flames, nefarious_pact
3:14.763 default S incinerate Fluffy_Pillow 137801.4/1100000: 13% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, nefarious_pact
3:15.718 default S incinerate Fluffy_Pillow 85604.7/1100000: 8% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, nefarious_pact
3:16.672 default T life_tap Fluffy_Pillow 33393.6/1100000: 3% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, devils_due
3:18.022 default H immolate Fluffy_Pillow 382906.1/1100000: 35% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, devils_due
3:19.371 default K conflagrate Fluffy_Pillow 336404.1/1100000: 31% mana | 1.0/5: 20% soul_shard lord_of_flames, devils_due
3:20.721 default R chaos_bolt Fluffy_Pillow 355916.6/1100000: 32% mana | 3.0/5: 60% soul_shard lord_of_flames, devils_due
3:23.418 default L conflagrate Fluffy_Pillow 394898.3/1100000: 36% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, devils_due
3:24.769 default R chaos_bolt Fluffy_Pillow 414425.2/1100000: 38% mana | 3.0/5: 60% soul_shard lord_of_flames, embrace_chaos
3:26.144 default L conflagrate Fluffy_Pillow 434299.1/1100000: 39% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos
3:27.290 default D havoc enemy2 450863.0/1100000: 41% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
3:28.435 default R chaos_bolt Fluffy_Pillow 379412.5/1100000: 34% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
3:29.810 default L conflagrate Fluffy_Pillow 399286.4/1100000: 36% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
3:30.955 default R chaos_bolt Fluffy_Pillow 415835.8/1100000: 38% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos
3:32.330 default S incinerate Fluffy_Pillow 435709.7/1100000: 40% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos
3:33.704 default L conflagrate Fluffy_Pillow 389569.1/1100000: 35% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos
3:34.878 default R chaos_bolt Fluffy_Pillow 406537.7/1100000: 37% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
3:36.252 default S incinerate Fluffy_Pillow 426397.1/1100000: 39% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
3:37.625 default S incinerate Fluffy_Pillow 380242.1/1100000: 35% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
3:38.997 default S incinerate Fluffy_Pillow 334072.6/1100000: 30% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
3:40.371 default S incinerate Fluffy_Pillow 287931.9/1100000: 26% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos
3:41.745 default F immolate Fluffy_Pillow 241791.3/1100000: 22% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos
3:42.890 default R chaos_bolt Fluffy_Pillow 192340.8/1100000: 17% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos
3:45.178 default S incinerate Fluffy_Pillow 225410.9/1100000: 20% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
3:46.551 default C use_item_kiljaedens_burning_wish Fluffy_Pillow 179255.9/1100000: 16% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
3:46.551 default Q dimensional_rift Fluffy_Pillow 179255.9/1100000: 16% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
3:47.696 default D havoc enemy2 195805.4/1100000: 18% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
3:48.840 default S incinerate Fluffy_Pillow 124340.4/1100000: 11% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
3:50.214 default S incinerate Fluffy_Pillow 78199.8/1100000: 7% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos
3:51.588 default T life_tap Fluffy_Pillow 32059.2/1100000: 3% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos
3:52.734 default H immolate Fluffy_Pillow 378623.1/1100000: 34% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos
3:53.879 default K conflagrate Fluffy_Pillow 329172.6/1100000: 30% mana | 1.0/5: 20% soul_shard lord_of_flames
3:55.026 default L conflagrate Fluffy_Pillow 345751.0/1100000: 31% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos
3:56.171 default O summon_doomguard Fluffy_Pillow 362300.5/1100000: 33% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos
3:57.316 default L conflagrate Fluffy_Pillow 378850.0/1100000: 34% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos
3:58.460 default R chaos_bolt Fluffy_Pillow 395385.0/1100000: 36% mana | 3.0/5: 60% soul_shard lord_of_flames
4:00.746 default R chaos_bolt Fluffy_Pillow 428426.2/1100000: 39% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos
4:02.119 default L conflagrate Fluffy_Pillow 448271.2/1100000: 41% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos
4:03.265 default S incinerate Fluffy_Pillow 464835.1/1100000: 42% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
4:04.638 default R chaos_bolt Fluffy_Pillow 418680.0/1100000: 38% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
4:06.009 default S incinerate Fluffy_Pillow 438496.1/1100000: 40% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
4:07.383 default P soul_harvest Fluffy_Pillow 392355.5/1100000: 36% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
4:07.564 default S incinerate Fluffy_Pillow 394971.6/1100000: 36% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos
4:08.936 default D havoc enemy2 348802.1/1100000: 32% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos
4:10.082 default L conflagrate Fluffy_Pillow 277366.0/1100000: 25% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos
4:11.229 default R chaos_bolt Fluffy_Pillow 293944.4/1100000: 27% mana | 2.0/5: 40% soul_shard soul_harvest, lord_of_flames
4:13.516 default S incinerate Fluffy_Pillow 327000.1/1100000: 30% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, embrace_chaos
4:14.888 default Q dimensional_rift Fluffy_Pillow 280830.5/1100000: 26% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, embrace_chaos
4:16.034 default F immolate Fluffy_Pillow 297394.5/1100000: 27% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, embrace_chaos
4:17.181 default R chaos_bolt Fluffy_Pillow 247972.9/1100000: 23% mana | 2.0/5: 40% soul_shard soul_harvest, lord_of_flames, embrace_chaos
4:18.554 default S incinerate Fluffy_Pillow 267817.8/1100000: 24% mana | 0.0/5: 0% soul_shard soul_harvest, lord_of_flames, embrace_chaos
4:19.928 default S incinerate Fluffy_Pillow 221677.2/1100000: 20% mana | 0.0/5: 0% soul_shard soul_harvest, lord_of_flames, embrace_chaos
4:21.301 default S incinerate Fluffy_Pillow 175522.2/1100000: 16% mana | 0.0/5: 0% soul_shard soul_harvest, lord_of_flames, embrace_chaos
4:22.676 default S incinerate Fluffy_Pillow 129396.0/1100000: 12% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames
4:24.050 default S incinerate Fluffy_Pillow 83255.4/1100000: 8% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames
4:25.422 default T life_tap Fluffy_Pillow 37085.9/1100000: 3% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames
4:26.568 default H immolate Fluffy_Pillow 383649.8/1100000: 35% mana | 1.0/5: 20% soul_shard lord_of_flames
4:27.714 default K conflagrate Fluffy_Pillow 334213.8/1100000: 30% mana | 1.0/5: 20% soul_shard lord_of_flames
4:28.858 default L conflagrate Fluffy_Pillow 350748.8/1100000: 32% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos
4:30.003 default D havoc enemy2 367298.3/1100000: 33% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos
4:31.148 default Q dimensional_rift Fluffy_Pillow 295847.8/1100000: 27% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos
4:32.292 default R chaos_bolt Fluffy_Pillow 312382.9/1100000: 28% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos
4:34.579 default L conflagrate Fluffy_Pillow 345438.5/1100000: 31% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
4:35.724 default R chaos_bolt Fluffy_Pillow 361988.0/1100000: 33% mana | 3.0/5: 60% soul_shard lord_of_flames, embrace_chaos
4:37.097 default K conflagrate Fluffy_Pillow 381832.9/1100000: 35% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos
4:38.244 default M service_imp Fluffy_Pillow 398411.3/1100000: 36% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
4:39.388 default S incinerate Fluffy_Pillow 414946.4/1100000: 38% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
4:40.759 default S incinerate Fluffy_Pillow 368762.4/1100000: 34% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
4:42.132 default K conflagrate Fluffy_Pillow 322607.3/1100000: 29% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos
4:43.369 default R chaos_bolt Fluffy_Pillow 340486.6/1100000: 31% mana | 2.0/5: 40% soul_shard lord_of_flames
4:45.655 default S incinerate Fluffy_Pillow 373527.7/1100000: 34% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos
4:47.029 default Q dimensional_rift Fluffy_Pillow 327387.1/1100000: 30% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos
4:48.176 default S incinerate Fluffy_Pillow 343965.5/1100000: 31% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos
4:49.549 default F immolate Fluffy_Pillow 297810.5/1100000: 27% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos
4:50.695 default D havoc enemy2 248374.4/1100000: 23% mana | 1.0/5: 20% soul_shard lord_of_flames
4:51.840 default G immolate enemy2 176923.9/1100000: 16% mana | 1.0/5: 20% soul_shard lord_of_flames
4:52.988 default K conflagrate Fluffy_Pillow 127516.8/1100000: 12% mana | 1.0/5: 20% soul_shard lord_of_flames
4:54.136 default R chaos_bolt Fluffy_Pillow 144109.6/1100000: 13% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos
4:56.423 default K conflagrate Fluffy_Pillow 177165.2/1100000: 16% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
4:57.569 default R chaos_bolt Fluffy_Pillow 193729.2/1100000: 18% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos
4:58.943 default S incinerate Fluffy_Pillow 213588.6/1100000: 19% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos
5:00.316 default S incinerate Fluffy_Pillow 167433.5/1100000: 15% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4201 3876 0
Agility 7254 6929 0
Stamina 51511 51511 33365
Intellect 50752 49046 39387 (4272)
Spirit 1 1 0
Health 3090660 3090660 0
Mana 1100000 1100000 0
Soul Shard 5 5 0
Spell Power 50752 49046 0
Crit 15.08% 15.08% 4033
Haste 31.40% 30.40% 11399
Damage / Heal Versatility 5.96% 5.96% 2829
ManaReg per Second 14454 14344 0
Mastery 69.57% 69.57% 6074
Armor 1954 1954 1954
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 906.00
Local Head Eyes of Azj'Aqir
ilevel: 900, stats: { 253 Armor, +3255 Sta, +2170 Int, +1074 Haste, +578 Vers }
Local Neck Radiant String of Scorpid Eyes
ilevel: 900, stats: { +1831 Sta, +2011 Haste, +922 Crit }, enchant: mark_of_the_hidden_satyr
Local Shoulders Pauldrons of Azj'Aqir
ilevel: 900, stats: { 233 Armor, +2442 Sta, +1628 Int, +752 Mastery, +487 Vers }
Local Chest Robes of Fluctuating Energy
ilevel: 900, stats: { 311 Armor, +3255 Sta, +2170 Int, +1145 Haste, +507 Mastery }
Local Waist Man'ari Skullbuckled Cinch
ilevel: 900, stats: { 175 Armor, +2442 Sta, +1628 Int, +699 Haste, +540 Mastery }
Local Legs Leggings of Azj'Aqir
ilevel: 900, stats: { 272 Armor, +3255 Sta, +2170 Int, +932 Crit, +720 Haste }
Local Feet Outcast Wanderer's Footrags
ilevel: 910, stats: { 222 Armor, +2680 Sta, +1786 Int, +864 Crit, +422 Mastery }
Local Wrists Woven Lasher Tendril Bracers
ilevel: 900, stats: { 136 Armor, +1831 Sta, +1221 Int, +644 Haste, +285 Vers }
Local Hands Clutch of Azj'Aqir
ilevel: 900, stats: { 194 Armor, +2442 Sta, +1628 Int, +859 Crit, +380 Mastery }
Local Finger1 Ring of the Scoured Clan
ilevel: 900, stats: { +1831 Sta, +2095 Mastery, +838 Haste }, enchant: { +200 Haste }
Local Finger2 Ring of Braided Stems
ilevel: 905, stats: { +1918 Sta, +1814 Haste, +1209 Vers }, enchant: { +200 Haste }
Local Trinket1 Whispers in the Dark
ilevel: 905, stats: { +2162 Int }
Local Trinket2 Kil'jaeden's Burning Wish
ilevel: 940, stats: { +2994 StrAgiInt, +456 Crit, +456 Mastery, +456 Haste }
Local Back Astromancer's Greatcloak
ilevel: 905, stats: { 158 Armor, +1918 Sta, +1278 StrAgiInt, +676 Haste, +270 Vers }, enchant: { +200 Int }
Local Main Hand Scepter of Sargeras
ilevel: 929, weapon: { 7005 - 10509, 3.6 }, stats: { +2843 Int, +4265 Sta, +922 Haste, +922 Mastery, +15509 Int }, relics: { +61 ilevels, +59 ilevels, +61 ilevels }

Talents

Level
15 Backdraft (Destruction Warlock) Roaring Blaze (Destruction Warlock) Shadowburn (Destruction Warlock)
30 Reverse Entropy (Destruction Warlock) Eradication (Destruction Warlock) Empowered Life Tap
45 Demonic Circle Mortal Coil Shadowfury
60 Cataclysm (Destruction Warlock) Fire and Brimstone (Destruction Warlock) Soul Harvest
75 Demon Skin Burning Rush Dark Pact
90 Grimoire of Supremacy Grimoire of Service Grimoire of Sacrifice
100 Wreak Havoc (Destruction Warlock) Channel Demonfire (Destruction Warlock) Soul Conduit

Profile

warlock="KJ_Trinket"
level=110
race=troll
role=spell
position=back
talents=2203021
artifact=38:142513:142516:142513:0:803:1:804:3:805:3:806:5:807:3:808:3:809:4:810:3:811:3:812:3:813:1:814:1:815:1:816:1:817:1:818:1:1355:1
spec=destruction

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,type=whispered_pact
actions.precombat+=/food,type=azshari_salad
actions.precombat+=/summon_pet,if=!talent.grimoire_of_supremacy.enabled&(!talent.grimoire_of_sacrifice.enabled|buff.demonic_power.down)
actions.precombat+=/summon_infernal,if=talent.grimoire_of_supremacy.enabled&artifact.lord_of_flames.rank>0
actions.precombat+=/summon_infernal,if=talent.grimoire_of_supremacy.enabled&active_enemies>1
actions.precombat+=/summon_doomguard,if=talent.grimoire_of_supremacy.enabled&active_enemies=1&artifact.lord_of_flames.rank=0
actions.precombat+=/augmentation,type=defiled
actions.precombat+=/snapshot_stats
actions.precombat+=/grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
actions.precombat+=/life_tap,if=talent.empowered_life_tap.enabled&!buff.empowered_life_tap.remains
actions.precombat+=/potion,name=prolonged_power
actions.precombat+=/chaos_bolt

# Executed every time the actor is available.
actions=use_item,name=kiljaedens_burning_wish
actions+=/havoc,target=2,if=active_enemies>1&(active_enemies<4|talent.wreak_havoc.enabled&active_enemies<6)&!debuff.havoc.remains
actions+=/dimensional_rift,if=charges=3
actions+=/immolate,if=remains<=tick_time
actions+=/immolate,cycle_targets=1,if=active_enemies>1&remains<=tick_time&(!talent.roaring_blaze.enabled|(!debuff.roaring_blaze.remains&action.conflagrate.charges<2))
actions+=/immolate,if=talent.roaring_blaze.enabled&remains<=duration&!debuff.roaring_blaze.remains&target.time_to_die>10&(action.conflagrate.charges=2+set_bonus.tier19_4pc|(action.conflagrate.charges>=1+set_bonus.tier19_4pc&action.conflagrate.recharge_time<cast_time+gcd)|target.time_to_die<24)
actions+=/berserking
actions+=/blood_fury
actions+=/arcane_torrent
actions+=/potion,name=deadly_grace,if=(buff.soul_harvest.remains|trinket.proc.any.react|target.time_to_die<=45)
actions+=/shadowburn,if=buff.conflagration_of_chaos.remains<=action.chaos_bolt.cast_time
actions+=/shadowburn,if=(charges=1&recharge_time<action.chaos_bolt.cast_time|charges=2)&soul_shard<5
actions+=/conflagrate,if=talent.roaring_blaze.enabled&(charges=2+set_bonus.tier19_4pc|(charges>=1+set_bonus.tier19_4pc&recharge_time<gcd)|target.time_to_die<24)
actions+=/conflagrate,if=talent.roaring_blaze.enabled&debuff.roaring_blaze.stack>0&dot.immolate.remains>dot.immolate.duration*0.3&(active_enemies=1|soul_shard<3)&soul_shard<5
actions+=/conflagrate,if=!talent.roaring_blaze.enabled&!buff.backdraft.remains&buff.conflagration_of_chaos.remains<=action.chaos_bolt.cast_time
actions+=/conflagrate,if=!talent.roaring_blaze.enabled&!buff.backdraft.remains&(charges=1&recharge_time<action.chaos_bolt.cast_time|charges=2)&soul_shard<5
actions+=/life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<=gcd
actions+=/dimensional_rift,if=equipped.144369&!buff.lessons_of_spacetime.remains&((!talent.grimoire_of_supremacy.enabled&!cooldown.summon_doomguard.remains)|(talent.grimoire_of_service.enabled&!cooldown.service_pet.remains)|(talent.soul_harvest.enabled&!cooldown.soul_harvest.remains))
actions+=/service_pet
actions+=/summon_infernal,if=artifact.lord_of_flames.rank>0&!buff.lord_of_flames.remains
actions+=/summon_doomguard,if=!talent.grimoire_of_supremacy.enabled&spell_targets.infernal_awakening<=2&(target.time_to_die>180|target.health.pct<=20|target.time_to_die<30)
actions+=/summon_infernal,if=!talent.grimoire_of_supremacy.enabled&spell_targets.infernal_awakening>2
actions+=/summon_doomguard,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal=1&artifact.lord_of_flames.rank>0&buff.lord_of_flames.remains&!pet.doomguard.active
actions+=/summon_doomguard,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal=1&equipped.132379&!cooldown.sindorei_spite_icd.remains
actions+=/summon_infernal,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal>1&equipped.132379&!cooldown.sindorei_spite_icd.remains
actions+=/soul_harvest
actions+=/channel_demonfire,if=dot.immolate.remains>cast_time
actions+=/havoc,if=active_enemies=1&talent.wreak_havoc.enabled&equipped.132375&!debuff.havoc.remains
actions+=/rain_of_fire,if=active_enemies>=3&cooldown.havoc.remains<=12&!talent.wreak_havoc.enabled
actions+=/rain_of_fire,if=active_enemies>=6&talent.wreak_havoc.enabled
actions+=/dimensional_rift,if=!equipped.144369|charges>1|((!talent.grimoire_of_service.enabled|recharge_time<cooldown.service_pet.remains)&(!talent.soul_harvest.enabled|recharge_time<cooldown.soul_harvest.remains)&(!talent.grimoire_of_supremacy.enabled|recharge_time<cooldown.summon_doomguard.remains))
actions+=/life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<duration*0.3
actions+=/cataclysm
actions+=/chaos_bolt,if=(cooldown.havoc.remains>12&cooldown.havoc.remains|active_enemies<3|talent.wreak_havoc.enabled&active_enemies<6)
actions+=/shadowburn
actions+=/conflagrate,if=!talent.roaring_blaze.enabled&!buff.backdraft.remains
actions+=/immolate,if=!talent.roaring_blaze.enabled&remains<=duration*0.3
actions+=/incinerate
actions+=/life_tap

head=eyes_of_azjaqir,id=138314,bonus_id=3445
neck=radiant_string_of_scorpid_eyes,id=140898,bonus_id=3445,enchant_id=5439
shoulders=pauldrons_of_azjaqir,id=138323,bonus_id=3445
back=astromancers_greatcloak,id=140909,bonus_id=3518,enchant_id=5436
chest=robes_of_fluctuating_energy,id=140848,bonus_id=3445
wrists=woven_lasher_tendril_bracers,id=140886,bonus_id=3445
hands=clutch_of_azjaqir,id=138311,bonus_id=3445
waist=manari_skullbuckled_cinch,id=140887,bonus_id=3445
legs=leggings_of_azjaqir,id=138317,bonus_id=3445
feet=outcast_wanderers_footrags,id=140914,bonus_id=3519
finger1=ring_of_the_scoured_clan,id=140897,bonus_id=3445,enchant=binding_of_haste
finger2=ring_of_braided_stems,id=140896,bonus_id=3518,enchant=binding_of_haste
trinket1=whispers_in_the_dark,id=140809,ilevel=905
trinket2=kiljaedens_burning_wish,id=144259,ilevel=940
main_hand=scepter_of_sargeras,id=128941,ilevel=929,gem_id=140826/140837/140826,relic_id=3519/3518:3518/3519

# Gear Summary
# gear_ilvl=906.27
# gear_stamina=33365
# gear_intellect=39387
# gear_crit_rating=4033
# gear_haste_rating=11399
# gear_mastery_rating=6074
# gear_versatility_rating=2829
# gear_armor=1954
# set_bonus=tier19_2pc=1
# set_bonus=tier19_4pc=1
default_pet=imp

Magistrike : 984064 dps, 576788 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
984064.0 984064.0 0.0 / 0.000% 0.0 / 0.0% 30.9
RPS Out RPS In Primary Resource Waiting APM Active Skill
26080.8 26080.8 Mana 0.00% 50.2 100.0% 100%
Talents
  • 15: Roaring Blaze (Destruction Warlock)
  • 30: Eradication (Destruction Warlock)
  • 60: Soul Harvest
  • 90: Grimoire of Service
  • 100: Wreak Havoc (Destruction Warlock)
  • Talent Calculator
Artifact

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Magistrike 984064
Chaos Bolt 318475 32.4% 57.1 5.12sec 1677813 1094995 Direct 108.8 0 880619 880619 100.0%  

Stats details: chaos_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 57.10 108.79 0.00 0.00 1.5323 0.0000 95801148.29 95801148.29 0.00 1094995.41 1094995.41
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 108.79 100.00% 880619.05 570822 1364369 880862.90 829663 941275 95801148 95801148 0.00
 
 

Action details: chaos_bolt

Static Values
  • id:116858
  • school:chromatic
  • resource:soul_shard
  • range:40.0
  • travel_speed:16.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:2.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:116858
  • name:Chaos Bolt
  • school:chromatic
  • tooltip:
  • description:Unleashes a devastating blast of chaos, causing {$s1=1} Chaos damage. Chaos Bolt always critically strikes and your critical strike chance increases its damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:4.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Conflagrate 106894 10.9% 48.0 6.26sec 668899 639006 Direct 95.5 198079 449936 336267 54.9%  

Stats details: conflagrate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 48.00 95.49 0.00 0.00 1.0468 0.0000 32108752.74 32108752.74 0.00 639005.59 639005.59
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 43.09 45.13% 198078.74 129994 310707 198187.20 177554 222988 8536063 8536063 0.00
crit 52.39 54.87% 449935.76 259994 718804 450042.06 401611 518870 23572689 23572689 0.00
 
 

Action details: conflagrate

Static Values
  • id:17962
  • school:fire
  • resource:chi
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:9.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.roaring_blaze.enabled&(charges=2+set_bonus.tier19_4pc|(charges>=1+set_bonus.tier19_4pc&recharge_time<gcd)|target.time_to_die<24)
Spelldata
  • id:17962
  • name:Conflagrate
  • school:fire
  • tooltip:
  • description:Triggers an explosion on the target, dealing {$s1=1} Fire damage.{$?s196406=false}[ Reduces the cast time of Incinerate and Chaos Bolt by {$117828s1=30}% for {$117828d=10 seconds}.][] |cFFFFFFFFGenerates 1 Soul Shard.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.265510
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Deadly Grace 5220 0.5% 14.2 2.10sec 108797 0 Direct 14.2 94046 188188 108799 15.7%  

Stats details: deadly_grace

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.17 14.17 0.00 0.00 0.0000 0.0000 1541140.48 1541140.48 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 11.95 84.33% 94045.63 83413 100096 94053.63 86750 100096 1123441 1123441 0.00
crit 2.22 15.67% 188188.25 166827 200192 169946.12 0 200192 417699 417699 0.00
 
 

Action details: deadly_grace

Static Values
  • id:188091
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:25.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188091
  • name:Deadly Grace
  • school:arcane
  • tooltip:
  • description:Deal {$s1=63339 to 95008} Arcane damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:63338.72
  • base_dd_max:95008.08
 
Immolate 235589 24.0% 19.8 15.39sec 3573220 3368238 Direct 38.4 136291 272642 201154 47.6%  
Periodic 290.9 146751 293560 216733 47.7% 195.9%

Stats details: immolate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 19.81 38.37 290.92 290.92 1.0609 2.0274 70770055.33 70770055.33 0.00 115858.84 3368238.32
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 20.12 52.43% 136290.96 90189 215418 136292.95 117456 155873 2742115 2742115 0.00
crit 18.25 47.57% 272642.06 180375 431046 272660.39 231186 318661 4976954 4976954 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 152.2 52.33% 146750.69 24 428277 147002.22 127332 172461 22341823 22341823 0.00
crit 138.7 47.67% 293560.12 90 856559 294064.14 251506 343337 40709163 40709163 0.00
 
 

Action details: immolate

Static Values
  • id:348
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:66000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.32
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:remains<=tick_time
Spelldata
  • id:348
  • name:Immolate
  • school:fire
  • tooltip:
  • description:Burns the enemy, causing {$s1=1} Fire damage immediately and an additional $157736o1 Fire damage over {$157736d=18 seconds}. |cFFFFFFFFPeriodic damage has a {$193541s1=15}% chance to generate 1 Soul Shard. Chance doubled on critical strikes.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.332000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.721500
  • base_td:0.00
  • dot_duration:18.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Incinerate 132935 13.5% 79.3 3.61sec 504258 405901 Direct 152.2 227333 454501 262881 15.6%  

Stats details: incinerate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 79.34 152.19 0.00 0.00 1.2423 0.0000 40007615.73 40007615.73 0.00 405900.83 405900.83
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 128.37 84.35% 227333.09 145789 348459 227401.77 210026 241753 29183560 29183560 0.00
crit 23.82 15.65% 454501.09 291579 696915 454573.27 387359 526249 10824055 10824055 0.00
 
 

Action details: incinerate

Static Values
  • id:29722
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:66000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:29722
  • name:Incinerate
  • school:fire
  • tooltip:
  • description:Draws fire toward the enemy, dealing {$s2=0} Fire damage.{$?s29722=true}|!c3[][ Replaces Shadow Bolt.]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.331000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Mark of the Hidden Satyr 8829 0.9% 19.8 15.09sec 133931 0 Direct 19.8 115746 231625 133931 15.7%  

Stats details: mark_of_the_hidden_satyr

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 19.82 19.82 0.00 0.00 0.0000 0.0000 2655150.05 2655150.05 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 16.71 84.31% 115746.10 110344 139315 115783.87 110344 125809 1934558 1934558 0.00
crit 3.11 15.69% 231624.96 220687 278630 221049.28 0 278630 720592 720592 0.00
 
 

Action details: mark_of_the_hidden_satyr

Static Values
  • id:191259
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191259
  • name:Mark of the Hidden Satyr
  • school:fire
  • tooltip:
  • description:Deals fire damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:2.500000
  • spell_power_mod.direct:2.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
pet - imp 41958 / 41958
Firebolt 41958 4.3% 107.9 2.79sec 116938 95271 Direct 107.0 101899 203737 117838 15.7%  

Stats details: firebolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 107.85 107.03 0.00 0.00 1.2274 0.0000 12612049.29 12612049.29 0.00 95270.84 95270.84
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 90.28 84.35% 101898.77 65104 123296 101925.20 99669 104361 9199100 9199100 0.00
crit 16.75 15.65% 203737.44 130208 246593 203788.35 179798 227463 3412950 3412950 0.00
 
 

Action details: firebolt

Static Values
  • id:3110
  • school:fire
  • resource:energy
  • range:40.0
  • travel_speed:16.0000
  • trigger_gcd:0.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.75
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:3110
  • name:Firebolt
  • school:fire
  • tooltip:
  • description:Deals {$s1=1} Fire damage to a target.$?a231795[ Damage increased by {$231795s1=50}% if you have Immolated the target.][] |cFF777777(Right-Click to toggle)|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
pet - service_imp 121574 / 38789
Firebolt 121574 3.9% 48.6 5.59sec 239098 207728 Direct 48.3 207867 415527 240463 15.7%  

Stats details: firebolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 48.61 48.33 0.00 0.00 1.1510 0.0000 11621739.76 11621739.76 0.00 207727.67 207727.67
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 40.74 84.30% 207867.44 130208 246593 208068.02 199337 216185 8469214 8469214 0.00
crit 7.59 15.70% 415526.84 260416 493185 415610.43 0 493185 3152525 3152525 0.00
 
 

Action details: firebolt

Static Values
  • id:3110
  • school:fire
  • resource:energy
  • range:40.0
  • travel_speed:16.0000
  • trigger_gcd:0.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.75
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:3110
  • name:Firebolt
  • school:fire
  • tooltip:
  • description:Deals {$s1=1} Fire damage to a target.$?a231795[ Damage increased by {$231795s1=50}% if you have Immolated the target.][] |cFF777777(Right-Click to toggle)|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
pet - infernal 115325 / 9765
Immolation 89775 0.8% 1.0 0.00sec 2244471 0 Periodic 46.3 41948 83904 48527 15.7% 8.1%

Stats details: immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 23.13 46.25 0.0000 1.0586 2244471.37 2244471.37 0.00 91685.92 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 39.0 84.32% 41947.80 36280 43536 41948.50 40634 43109 1635996 1635996 0.00
crit 7.3 15.68% 83904.13 72560 87072 83886.94 0 87072 608475 608475 0.00
 
 

Action details: immolation

Static Values
  • id:19483
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!ticking
Spelldata
  • id:19483
  • name:Immolation
  • school:fire
  • tooltip:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
 

Action details: immolation_tick

Static Values
  • id:20153
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all enemies near the caster.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
melee 25550 0.2% 22.0 1.12sec 29034 26097 Direct 22.0 25100 50191 29035 15.7%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.00 22.00 0.00 0.00 1.1126 0.0000 638764.72 939044.64 31.98 26096.53 26096.53
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 18.55 84.32% 25100.11 21696 26035 25100.07 24485 26035 465630 684520 31.98
crit 3.45 15.68% 50191.14 43391 52069 48996.99 0 52069 173135 254524 31.21
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
pet - doomguard 93093 / 7878
Doom Bolt 93093 0.8% 10.7 2.22sec 217411 99984 Direct 10.7 188250 376165 217428 15.5%  

Stats details: doom_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.70 10.70 0.00 0.00 2.1745 0.0000 2327337.83 2327337.83 0.00 99984.44 99984.44
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 9.04 84.47% 188249.90 182068 218482 188249.89 182068 218482 1702162 1702162 0.00
crit 1.66 15.53% 376164.84 364136 436964 313416.56 0 436964 625176 625176 0.00
 
 

Action details: doom_bolt

Static Values
  • id:85692
  • school:shadow
  • resource:energy
  • range:30.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:35.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:85692
  • name:Doom Bolt
  • school:shadow
  • tooltip:
  • description:Sends a shadowy bolt at the enemy, causing {$s1=1} Shadow damage. Deals {$s2=20}% additional damage to targets below 20% health.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
pet - lord_of_flames_infernal 115304 / 9764
Immolation 89765 0.8% 1.0 0.00sec 2244220 0 Periodic 46.3 41949 83890 48520 15.7% 8.1%

Stats details: immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 23.13 46.25 0.0000 1.0586 2244219.56 2244219.56 0.00 91675.64 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 39.0 84.33% 41949.12 36280 43536 41950.16 40996 43190 1636248 1636248 0.00
crit 7.2 15.67% 83889.98 72560 87072 83832.84 0 87072 607971 607971 0.00
 
 

Action details: immolation

Static Values
  • id:19483
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!ticking
Spelldata
  • id:19483
  • name:Immolation
  • school:fire
  • tooltip:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
 

Action details: immolation_tick

Static Values
  • id:20153
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all enemies near the caster.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
melee 25539 0.2% 22.0 1.12sec 29022 26086 Direct 22.0 25097 50221 29022 15.6%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.00 22.00 0.00 0.00 1.1126 0.0000 638506.08 938664.42 31.98 26085.96 26085.96
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 18.56 84.38% 25097.33 21696 26035 25097.20 24366 26035 465889 684900 31.98
crit 3.44 15.62% 50221.18 43391 52069 49056.15 0 52069 172617 253764 31.24
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
pet - lord_of_flames_infernal 115361 / 9768
Immolation 89832 0.8% 1.0 0.00sec 2245882 0 Periodic 46.3 41947 83914 48557 15.8% 8.1%

Stats details: immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 23.13 46.25 0.0000 1.0586 2245882.07 2245882.07 0.00 91743.55 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 39.0 84.25% 41946.89 36280 43536 41947.60 40987 43018 1634586 1634586 0.00
crit 7.3 15.75% 83913.83 72560 87072 83888.07 0 87072 611296 611296 0.00
 
 

Action details: immolation

Static Values
  • id:19483
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!ticking
Spelldata
  • id:19483
  • name:Immolation
  • school:fire
  • tooltip:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
 

Action details: immolation_tick

Static Values
  • id:20153
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all enemies near the caster.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
melee 25530 0.2% 22.0 1.12sec 29012 26076 Direct 22.0 25101 50186 29011 15.6%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.00 22.00 0.00 0.00 1.1126 0.0000 638266.97 938312.90 31.98 26076.19 26076.19
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 18.57 84.41% 25100.61 21696 26035 25100.82 24485 26035 466128 685252 31.98
crit 3.43 15.59% 50185.73 43391 52069 49053.98 0 52069 172139 253061 31.26
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
pet - lord_of_flames_infernal 115287 / 9763
Immolation 89730 0.8% 1.0 0.00sec 2243349 0 Periodic 46.3 41950 83879 48501 15.6% 8.1%

Stats details: immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 23.13 46.25 0.0000 1.0586 2243348.75 2243348.75 0.00 91640.06 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 39.0 84.37% 41950.12 36280 43536 41951.23 40672 43182 1637119 1637119 0.00
crit 7.2 15.63% 83879.15 72560 87072 83874.20 0 87072 606230 606230 0.00
 
 

Action details: immolation

Static Values
  • id:19483
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!ticking
Spelldata
  • id:19483
  • name:Immolation
  • school:fire
  • tooltip:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
 

Action details: immolation_tick

Static Values
  • id:20153
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all enemies near the caster.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
melee 25557 0.2% 22.0 1.12sec 29043 26104 Direct 22.0 25099 50205 29043 15.7%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.00 22.00 0.00 0.00 1.1126 0.0000 638946.98 939312.58 31.98 26103.97 26103.97
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 18.54 84.29% 25098.85 21696 26035 25098.63 24227 26035 465448 684252 31.98
crit 3.46 15.71% 50204.75 43391 52069 49133.01 0 52069 173499 255060 31.30
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
pet - shadowy_tear 120832 / 20559
Shadow Bolt 120832 2.1% 4.4 59.31sec 1395485 0 Periodic 48.3 110099 219831 127329 15.7% 19.9%

Stats details: shadow_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.41 0.00 48.61 48.33 0.0000 1.2339 6153831.73 6153831.73 0.00 102606.61 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 40.7 84.30% 110099.16 68 133958 109799.77 0 133958 4485646 4485646 0.00
crit 7.6 15.70% 219830.56 117 267916 217096.02 0 267916 1668185 1668185 0.00
 
 

Action details: shadow_bolt

Static Values
  • id:196657
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:196657
  • name:Shadow Bolt
  • school:shadow
  • tooltip:
  • description:Sends a shadowy bolt at the enemy, causing {$s1=1} Shadow damage.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:14.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
pet - chaos_tear 138515 / 9615
Chaos Bolt 138515 1.0% 4.4 59.44sec 656822 328264 Direct 4.4 0 661382 661382 100.0%  

Stats details: chaos_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.39 4.35 0.00 0.00 2.0010 0.0000 2880192.16 2880192.16 0.00 328264.44 328264.44
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 4.35 100.00% 661382.12 613669 774793 662245.29 0 774793 2880192 2880192 0.00
 
 

Action details: chaos_bolt

Static Values
  • id:215279
  • school:chromatic
  • resource:none
  • range:100.0
  • travel_speed:16.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:5.500
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:215279
  • name:Chaos Bolt
  • school:chromatic
  • tooltip:
  • description:Unleashes a devastating blast of chaos, causing {$s1=1} Chaos damage. Chaos Bolt always critically strikes and your critical strike chance increases its damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:5.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
pet - chaos_portal 246259 / 18639
Chaos Barrage 246259 1.9% 4.4 57.96sec 1260951 0 Periodic 153.2 31452 62940 36380 15.7% 8.0%

Stats details: chaos_barrage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.42 0.00 153.96 153.21 0.0000 0.1560 5573860.42 5573860.42 0.00 232079.79 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 129.2 84.35% 31452.02 127 36839 31392.83 0 36839 4064557 4064557 0.00
crit 24.0 15.65% 62939.83 255 73679 62820.96 0 73679 1509304 1509304 0.00
 
 

Action details: chaos_barrage

Static Values
  • id:187394
  • school:magic
  • resource:none
  • range:100.0
  • travel_speed:24.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:187394
  • name:Chaos Barrage
  • school:magic
  • tooltip:
  • description:Deals {$s1=1} Chaos damage.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:5.50
  • base_tick_time:0.25
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Simple Action Stats Execute Interval
Magistrike
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Magistrike
  • harmful:false
  • if_expr:
 
Berserking 2.1 180.52sec

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.08 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=15}%.
  • description:Increases your haste by {$s1=15}% for {$d=10 seconds}.
 
Dimensional Rift 13.1 23.33sec

Stats details: dimensional_rift

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.14 0.00 0.00 0.00 1.0182 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: dimensional_rift

Static Values
  • id:196586
  • school:none
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:45.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:charges=3
Spelldata
  • id:196586
  • name:Dimensional Rift
  • school:chaos
  • tooltip:
  • description:Rips a hole in time and space, opening a portal that damages your target.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Magistrike
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Magistrike
  • harmful:false
  • if_expr:
 
Havoc 14.9 20.93sec

Stats details: havoc

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.89 0.00 0.00 0.00 1.0768 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: havoc

Static Values
  • id:80240
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:88000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies>1&(active_enemies<4|talent.wreak_havoc.enabled&active_enemies<6)&!debuff.havoc.remains
Spelldata
  • id:80240
  • name:Havoc
  • school:shadow
  • tooltip:Spells cast by the Warlock also hit this target.
  • description:Marks a target with Havoc for {$d=8 seconds}, causing your single target spells to also strike the Havoc victim. Limit 1.
 
Life Tap 7.5 30.60sec

Stats details: life_tap

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.55 0.00 0.00 0.00 1.0569 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: life_tap

Static Values
  • id:1454
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.empowered_life_tap.enabled&!buff.empowered_life_tap.remains
Spelldata
  • id:1454
  • name:Life Tap
  • school:shadow
  • tooltip:
  • description:Restores {$s1=30}% of your maximum mana, at the cost of {$s2=10}% of your maximum health.
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Grimoire: Imp (service_imp) 3.7 91.79sec

Stats details: service_imp

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.67 0.00 0.00 0.00 0.9795 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: service_imp

Static Values
  • id:111859
  • school:shadow
  • resource:soul_shard
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:90.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:111859
  • name:Grimoire: Imp
  • school:shadow
  • tooltip:
  • description:Summons an Imp who attacks the target for {$108501s1=25} sec. Imps cast ranged Firebolts and cleanse a hostile magic effect from their master.
 
Soul Harvest 2.9 120.93sec

Stats details: soul_harvest

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.90 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: soul_harvest

Static Values
  • id:196098
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:196098
  • name:Soul Harvest
  • school:shadow
  • tooltip:Damage increased by {$s1=20}%.
  • description:Increases your damage and your pets' damage by {$s1=20}%. Lasts {$d=15 seconds}, increased by {$s2=2} sec for each target afflicted by your {$?s137043=false}[Agony][]{$?s137044=false}[Doom][]{$?s137046=false}[Immolate][], up to a maximum of {$s3=35} sec.
 
Summon Doomguard 1.0 0.00sec

Stats details: summon_doomguard

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 1.0923 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_doomguard

Static Values
  • id:18540
  • school:shadow
  • resource:soul_shard
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.grimoire_of_supremacy.enabled&active_enemies=1&artifact.lord_of_flames.rank=0
Spelldata
  • id:18540
  • name:Summon Doomguard
  • school:shadow
  • tooltip:
  • description:Summons a Doomguard for {$60478d=25 seconds} to assault the target with its Doom Bolts.
 
Summon Imp 1.0 0.00sec

Stats details: summon_imp

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_imp

Static Values
  • id:688
  • school:shadow
  • resource:soul_shard
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!talent.grimoire_of_supremacy.enabled&(!talent.grimoire_of_sacrifice.enabled|buff.demonic_power.down)
Spelldata
  • id:688
  • name:Summon Imp
  • school:shadow
  • tooltip:
  • description:Summons an Imp under your command that casts ranged Firebolts.$?s74434[ |cFFFFFFFFSoulburn:|r |cFF8282FFInstant cast.|r][]
 
Summon Infernal 1.0 0.00sec

Stats details: summon_infernal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.7615 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_infernal

Static Values
  • id:1122
  • school:shadow
  • resource:soul_shard
  • range:30.0
  • travel_speed:1.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.grimoire_of_supremacy.enabled&artifact.lord_of_flames.rank>0
Spelldata
  • id:1122
  • name:Summon Infernal
  • school:shadow
  • tooltip:
  • description:Summons an Infernal from the Twisting Nether, impacting for {$22703s1=0} Fire damage and stunning all enemy targets in the area for {$22703d=2 seconds}. The Infernal will serve you for {$111685d=25 seconds}, dealing strong area-of-effect damage.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Accelerando 20.1 0.0 15.4sec 15.4sec 78.50% 78.50% 1.4(1.4) 19.3

Buff details

  • buff initial source:Magistrike
  • cooldown name:buff_accelerando
  • max_stacks:5
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:734.41

Stack Uptimes

  • accelerando_1:29.72%
  • accelerando_2:24.61%
  • accelerando_3:14.71%
  • accelerando_4:6.55%
  • accelerando_5:2.91%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225719
  • name:Accelerando
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc225125=Your damaging spells have a chance to grant you {$225719s1=528} Haste for {$225719d=12 seconds}, stacking up to 5 times. Stacking does not refresh duration.}
  • max_stacks:5
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Berserking 2.1 0.0 180.5sec 180.5sec 6.87% 8.33% 0.0(0.0) 2.0

Buff details

  • buff initial source:Magistrike
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:10.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • berserking_1:6.87%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=15}%.
  • description:Increases your haste by {$s1=15}% for {$d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.55% 15.44% 0.0(0.0) 1.0

Buff details

  • buff initial source:Magistrike
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:13.55%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Conflagration of Chaos 24.0 0.0 12.4sec 12.4sec 49.18% 46.49% 0.0(0.0) 1.2

Buff details

  • buff initial source:Magistrike
  • cooldown name:buff_conflagration_of_chaos
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:50.00%
  • default_value:-0.00

Stack Uptimes

  • conflagration_of_chaos_1:49.18%

Trigger Attempt Success

  • trigger_pct:50.00%

Spelldata details

  • id:196546
  • name:Conflagration of Chaos
  • tooltip:Your {$?s17877=false}[Shadowburn][Conflagrate] will always critically strike. Critical strike chance will increase the critical strike damage of {$?s17877=false}[Shadowburn][Conflagrate].
  • description:{$@spelldesc219195={$?s17877=false}[Shadowburn][Conflagrate] has a chance to guarantee your next {$?s17877=false}[Shadowburn][Conflagrate] critically strikes, and to increase its damage by your critical strike chance.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Devil's Due 3.5 0.0 68.9sec 68.9sec 8.76% 10.29% 0.0(0.0) 3.3

Buff details

  • buff initial source:Magistrike
  • cooldown name:buff_devils_due
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.18

Stack Uptimes

  • devils_due_1:8.76%

Trigger Attempt Success

  • trigger_pct:99.96%

Spelldata details

  • id:225776
  • name:Devil's Due
  • tooltip:Cast speed slowed by {$s1=7}%.
  • description:{$@spelldesc225142=Your damaging spells have a chance to grant Nefarious Pact, increasing your casting speed by {$225774s1=17}% for {$225774d=12 seconds}. When Nefarious Pact expires, your casting speed is decreased by {$225776s1=7}% for {$225776d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Embrace Chaos 26.1 32.0 11.8sec 5.1sec 58.97% 66.56% 32.0(32.0) 25.4

Buff details

  • buff initial source:Magistrike
  • cooldown name:buff_embrace_chaos
  • max_stacks:1
  • duration:4.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • embrace_chaos_1:58.97%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:212019
  • name:Embrace Chaos
  • tooltip:Chaos Bolt has {$s1=40}% reduced cast time.
  • description:{$@spelldesc212018=Casting Chaos Bolt reduces the cast time of your next Chaos Bolt by {$212019s1=40}% for {$212019d=4 seconds}.}
  • max_stacks:0
  • duration:4.00
  • cooldown:0.00
  • default_chance:0.00%
Lord of Flames 1.0 0.0 0.0sec 0.0sec 97.86% 97.86% 0.0(0.0) 0.0

Buff details

  • buff initial source:Magistrike
  • cooldown name:buff_lord_of_flames
  • max_stacks:1
  • duration:600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • lord_of_flames_1:97.86%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:226802
  • name:Lord of Flames
  • tooltip:Recently activated Lord of Flames.
  • description:{$@spelldesc224103=Once every {$s2=10} minutes, {$?s152107=false}[your Infernal's Meteor Strike][Summon Infernal] will summon {$s3=3} additional Infernals to serve you for {$226804d=25 seconds}.}
  • max_stacks:0
  • duration:600.00
  • cooldown:0.00
  • default_chance:0.00%
Nefarious Pact 3.5 0.0 69.2sec 68.6sec 13.61% 15.09% 0.0(0.0) 3.3

Buff details

  • buff initial source:Magistrike
  • cooldown name:buff_nefarious_pact
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.44

Stack Uptimes

  • nefarious_pact_1:13.61%

Trigger Attempt Success

  • trigger_pct:99.96%

Spelldata details

  • id:225774
  • name:Nefarious Pact
  • tooltip:Cast speed increased by {$s1=17}%.
  • description:{$@spelldesc225142=Your damaging spells have a chance to grant Nefarious Pact, increasing your casting speed by {$225774s1=17}% for {$225774d=12 seconds}. When Nefarious Pact expires, your casting speed is decreased by {$225776s1=7}% for {$225776d=8 seconds}.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of Deadly Grace 1.0 0.0 0.0sec 0.0sec 10.16% 10.16% 0.0(0.0) 1.0

Buff details

  • buff initial source:Magistrike
  • cooldown name:buff_potion_of_deadly_grace
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_deadly_grace_1:10.16%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188027
  • name:Potion of Deadly Grace
  • tooltip:Your attacks have a chance to unleash a bolt of energy at your target.
  • description:Grants your attacks a chance to unleash a bolt of energy at your target. Staying away from enemies for the entire duration of the effect will extend the effect by an additional 5 seconds.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
Potion of Prolonged Power 1.0 0.0 0.0sec 0.0sec 19.64% 19.64% 0.0(0.0) 1.0

Buff details

  • buff initial source:Magistrike
  • cooldown name:buff_potion_of_prolonged_power
  • max_stacks:1
  • duration:60.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:all
  • amount:2500.00

Stack Uptimes

  • potion_of_prolonged_power_1:19.64%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:229206
  • name:Potion of Prolonged Power
  • tooltip:All stats increased by {$s1=2500}.
  • description:Drink to increase all stats by {$s1=2500} for {$d=60 seconds}.
  • max_stacks:0
  • duration:60.00
  • cooldown:1.00
  • default_chance:0.00%
Soul Harvest 2.9 0.0 120.9sec 120.9sec 17.76% 17.76% 0.0(0.0) 2.7

Buff details

  • buff initial source:Magistrike
  • cooldown name:buff_soul_harvest
  • max_stacks:1
  • duration:15.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • soul_harvest_1:17.76%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:196098
  • name:Soul Harvest
  • tooltip:Damage increased by {$s1=20}%.
  • description:Increases your damage and your pets' damage by {$s1=20}%. Lasts {$d=15 seconds}, increased by {$s2=2} sec for each target afflicted by your {$?s137043=false}[Agony][]{$?s137044=false}[Doom][]{$?s137046=false}[Immolate][], up to a maximum of {$s3=35} sec.
  • max_stacks:0
  • duration:15.00
  • cooldown:120.00
  • default_chance:0.00%
Constant Buffs
Well Fed (azshari_salad)

Buff details

  • buff initial source:Magistrike
  • cooldown name:buff_azshari_salad
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:375.00

Stack Uptimes

  • azshari_salad_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225603
  • name:Well Fed
  • tooltip:Haste increased by $w1.
  • description:Increases haste by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Defiled Augmentation

Buff details

  • buff initial source:Magistrike
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Whispered Pact

Buff details

  • buff initial source:Magistrike
  • cooldown name:buff_flask_of_the_whispered_pact
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:1300.00

Stack Uptimes

  • flask_of_the_whispered_pact_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188031
  • name:Flask of the Whispered Pact
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%

Procs

Count Interval
shadowy_tear 4.4 59.1sec
chaos_tear 4.4 59.0sec
chaos_portal 4.4 58.8sec
dimension_ripper 4.0 54.3sec

Resources

Resource Usage Type Count Total Average RPE APR
Magistrike
chaos_bolt Soul Shard 58.1 116.2 2.0 2.0 824465.1
havoc Mana 14.9 1309918.2 88000.0 88000.3 0.0
immolate Mana 19.8 1307166.8 66000.0 65999.6 54.1
incinerate Mana 79.3 5236413.5 66000.0 66000.0 7.6
service_imp Soul Shard 3.7 3.7 1.0 1.0 0.0
summon_doomguard Soul Shard 1.0 1.0 1.0 1.0 0.0
summon_infernal Soul Shard 1.0 1.0 1.0 1.0 0.0
pet - imp
firebolt Energy 107.9 4314.1 40.0 40.0 2923.5
pet - service_imp
firebolt Energy 48.6 1944.3 40.0 40.0 5977.4
pet - doomguard
doom_bolt Energy 10.7 374.7 35.0 35.0 6211.8
Resource Gains Type Count Total Average Overflow
life_tap Mana 7.55 2491049.69 (35.63%) 330000.00 0.00 0.00%
immolate Soul Shard 64.41 63.87 (52.99%) 0.99 0.54 0.83%
conflagrate Soul Shard 48.00 47.95 (39.78%) 1.00 0.05 0.11%
mp5_regen Mana 472.81 4500601.39 (64.37%) 9518.91 87680.47 1.91%
soulsnatcher Soul Shard 8.71 8.71 (7.23%) 1.00 0.00 0.00%
pet - imp
energy_regen Energy 1900.00 4147.77 (100.00%) 2.18 21.61 0.52%
pet - service_imp
energy_regen Energy 438.74 1325.07 (100.00%) 3.02 61.66 4.45%
pet - doomguard
energy_regen Energy 15.46 333.48 (100.00%) 21.57 42.67 11.34%
Resource RPS-Gain RPS-Loss
Health 0.00 7911.88
Mana 23218.72 26080.81
Soul Shard 0.40 0.40
Combat End Resource Mean Min Max
Mana 238885.53 10439.04 506941.07
Soul Shard 1.65 0.00 5.00

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 1.4%

Statistics & Data Analysis

Fight Length
Sample Data Magistrike Fight Length
Count 9999
Mean 301.12
Minimum 221.26
Maximum 379.15
Spread ( max - min ) 157.89
Range [ ( max - min ) / 2 * 100% ] 26.22%
DPS
Sample Data Magistrike Damage Per Second
Count 9999
Mean 984064.01
Minimum 883668.32
Maximum 1114587.80
Spread ( max - min ) 230919.49
Range [ ( max - min ) / 2 * 100% ] 11.73%
Priority Target DPS
Sample Data Magistrike Priority Target Damage Per Second
Count 9999
Mean 576788.23
Minimum 510554.92
Maximum 659312.21
Spread ( max - min ) 148757.29
Range [ ( max - min ) / 2 * 100% ] 12.90%
DPS(e)
Sample Data Magistrike Damage Per Second (Effective)
Count 9999
Mean 984064.01
Minimum 883668.32
Maximum 1114587.80
Spread ( max - min ) 230919.49
Range [ ( max - min ) / 2 * 100% ] 11.73%
Damage
Sample Data Magistrike Damage
Count 9999
Mean 242883862.64
Minimum 171671244.31
Maximum 327955058.18
Spread ( max - min ) 156283813.86
Range [ ( max - min ) / 2 * 100% ] 32.17%
DTPS
Sample Data Magistrike Damage Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Magistrike Healing Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS(e)
Sample Data Magistrike Healing Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Magistrike Heal
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Magistrike Healing Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Magistrike Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
ETMI
Sample Data MagistrikeTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data Magistrike Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=whispered_pact
1 0.00 food,type=azshari_salad
2 0.00 summon_pet,if=!talent.grimoire_of_supremacy.enabled&(!talent.grimoire_of_sacrifice.enabled|buff.demonic_power.down)
3 0.00 summon_infernal,if=talent.grimoire_of_supremacy.enabled&artifact.lord_of_flames.rank>0
4 0.00 summon_infernal,if=talent.grimoire_of_supremacy.enabled&active_enemies>1
5 0.00 summon_doomguard,if=talent.grimoire_of_supremacy.enabled&active_enemies=1&artifact.lord_of_flames.rank=0
6 0.00 augmentation,type=defiled
7 0.00 snapshot_stats
8 0.00 grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
9 0.00 life_tap,if=talent.empowered_life_tap.enabled&!buff.empowered_life_tap.remains
A 0.00 potion,name=prolonged_power
B 0.00 chaos_bolt
Default action list Executed every time the actor is available.
# count action,conditions
C 14.89 havoc,target=2,if=active_enemies>1&(active_enemies<4|talent.wreak_havoc.enabled&active_enemies<6)&!debuff.havoc.remains
D 1.00 dimensional_rift,if=charges=3
E 10.28 immolate,if=remains<=tick_time
F 0.61 immolate,cycle_targets=1,if=active_enemies>1&remains<=tick_time&(!talent.roaring_blaze.enabled|(!debuff.roaring_blaze.remains&action.conflagrate.charges<2))
G 8.96 immolate,if=talent.roaring_blaze.enabled&remains<=duration&!debuff.roaring_blaze.remains&target.time_to_die>10&(action.conflagrate.charges=2+set_bonus.tier19_4pc|(action.conflagrate.charges>=1+set_bonus.tier19_4pc&action.conflagrate.recharge_time<cast_time+gcd)|target.time_to_die<24)
H 2.07 berserking
0.00 blood_fury
0.00 arcane_torrent
I 1.00 potion,name=deadly_grace,if=(buff.soul_harvest.remains|trinket.proc.any.react|target.time_to_die<=45)
0.00 shadowburn,if=buff.conflagration_of_chaos.remains<=action.chaos_bolt.cast_time
0.00 shadowburn,if=(charges=1&recharge_time<action.chaos_bolt.cast_time|charges=2)&soul_shard<5
J 13.79 conflagrate,if=talent.roaring_blaze.enabled&(charges=2+set_bonus.tier19_4pc|(charges>=1+set_bonus.tier19_4pc&recharge_time<gcd)|target.time_to_die<24)
K 34.22 conflagrate,if=talent.roaring_blaze.enabled&debuff.roaring_blaze.stack>0&dot.immolate.remains>dot.immolate.duration*0.3&(active_enemies=1|soul_shard<3)&soul_shard<5
0.00 conflagrate,if=!talent.roaring_blaze.enabled&!buff.backdraft.remains&buff.conflagration_of_chaos.remains<=action.chaos_bolt.cast_time
0.00 conflagrate,if=!talent.roaring_blaze.enabled&!buff.backdraft.remains&(charges=1&recharge_time<action.chaos_bolt.cast_time|charges=2)&soul_shard<5
0.00 life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<=gcd
0.00 dimensional_rift,if=equipped.144369&!buff.lessons_of_spacetime.remains&((!talent.grimoire_of_supremacy.enabled&!cooldown.summon_doomguard.remains)|(talent.grimoire_of_service.enabled&!cooldown.service_pet.remains)|(talent.soul_harvest.enabled&!cooldown.soul_harvest.remains))
L 3.67 service_pet
M 1.00 summon_infernal,if=artifact.lord_of_flames.rank>0&!buff.lord_of_flames.remains
N 1.00 summon_doomguard,if=!talent.grimoire_of_supremacy.enabled&spell_targets.infernal_awakening<=2&(target.time_to_die>180|target.health.pct<=20|target.time_to_die<30)
0.00 summon_infernal,if=!talent.grimoire_of_supremacy.enabled&spell_targets.infernal_awakening>2
0.00 summon_doomguard,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal=1&artifact.lord_of_flames.rank>0&buff.lord_of_flames.remains&!pet.doomguard.active
0.00 summon_doomguard,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal=1&equipped.132379&!cooldown.sindorei_spite_icd.remains
0.00 summon_infernal,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal>1&equipped.132379&!cooldown.sindorei_spite_icd.remains
O 2.90 soul_harvest
0.00 channel_demonfire,if=dot.immolate.remains>cast_time
0.00 havoc,if=active_enemies=1&talent.wreak_havoc.enabled&equipped.132375&!debuff.havoc.remains
0.00 rain_of_fire,if=active_enemies>=3&cooldown.havoc.remains<=12&!talent.wreak_havoc.enabled
0.00 rain_of_fire,if=active_enemies>=6&talent.wreak_havoc.enabled
P 12.14 dimensional_rift,if=!equipped.144369|charges>1|((!talent.grimoire_of_service.enabled|recharge_time<cooldown.service_pet.remains)&(!talent.soul_harvest.enabled|recharge_time<cooldown.soul_harvest.remains)&(!talent.grimoire_of_supremacy.enabled|recharge_time<cooldown.summon_doomguard.remains))
0.00 life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<duration*0.3
0.00 cataclysm
Q 57.41 chaos_bolt,if=(cooldown.havoc.remains>12&cooldown.havoc.remains|active_enemies<3|talent.wreak_havoc.enabled&active_enemies<6)
0.00 shadowburn
0.00 conflagrate,if=!talent.roaring_blaze.enabled&!buff.backdraft.remains
0.00 immolate,if=!talent.roaring_blaze.enabled&remains<=duration*0.3
R 79.68 incinerate
S 7.55 life_tap

Sample Sequence

0126ABCDEGHJLKMOPPQQKQKKQQRRKQCQRRRRERRRRRGJKQKQKQCQRRKPRRRRRERRRSCRGJKQKQKRRQRRRKQRCQSRRERRPQLRGJKQCKQQKQRQKRRRSREQCQOIQRQGJKQPQKQKQRCRKQRRERRSRRQRCGJKQKQKQRRRKPQCHLRERSRRRRRGJKQKQCKQQRPRKQQRRSRRRERRPCQGJKKNQRKQRSRQORKCQRRRRSERRRRRRGJQKCKPQJLQQJRRQRJESCRQJRRR

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask Magistrike 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 1 food Magistrike 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 2 summon_imp Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 6 augmentation Magistrike 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat A potion Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard potion_of_prolonged_power
0:00.000 precombat B chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 2.0/5: 40% soul_shard embrace_chaos, accelerando, potion_of_prolonged_power
0:00.000 default C havoc enemy2 1100000.0/1100000: 100% mana | 2.0/5: 40% soul_shard embrace_chaos, accelerando, potion_of_prolonged_power
0:01.153 default D dimensional_rift Fluffy_Pillow 1033503.7/1100000: 94% mana | 2.0/5: 40% soul_shard bloodlust, embrace_chaos, accelerando, potion_of_prolonged_power
0:02.041 default E immolate Fluffy_Pillow 1050065.2/1100000: 95% mana | 2.0/5: 40% soul_shard bloodlust, embrace_chaos, accelerando, potion_of_prolonged_power
0:02.930 default G immolate Fluffy_Pillow 1000645.2/1100000: 91% mana | 2.0/5: 40% soul_shard bloodlust, embrace_chaos, accelerando, potion_of_prolonged_power
0:03.817 default H berserking Fluffy_Pillow 951188.0/1100000: 86% mana | 2.0/5: 40% soul_shard bloodlust, embrace_chaos, accelerando, potion_of_prolonged_power
0:03.817 default J conflagrate Fluffy_Pillow 951188.0/1100000: 86% mana | 2.0/5: 40% soul_shard bloodlust, berserking, embrace_chaos, accelerando, potion_of_prolonged_power
0:04.593 default L service_imp Fluffy_Pillow 967831.5/1100000: 88% mana | 3.0/5: 60% soul_shard bloodlust, berserking, accelerando, potion_of_prolonged_power
0:05.366 default K conflagrate Fluffy_Pillow 984410.6/1100000: 89% mana | 2.0/5: 40% soul_shard bloodlust, berserking, accelerando, potion_of_prolonged_power
0:06.139 default M summon_infernal Fluffy_Pillow 1000989.8/1100000: 91% mana | 3.0/5: 60% soul_shard bloodlust, berserking, conflagration_of_chaos, accelerando, potion_of_prolonged_power
0:06.911 default O soul_harvest Fluffy_Pillow 1017547.5/1100000: 93% mana | 3.0/5: 60% soul_shard bloodlust, berserking, lord_of_flames, conflagration_of_chaos, accelerando, potion_of_prolonged_power
0:06.911 default P dimensional_rift Fluffy_Pillow 1017547.5/1100000: 93% mana | 3.0/5: 60% soul_shard bloodlust, berserking, soul_harvest, lord_of_flames, conflagration_of_chaos, accelerando, potion_of_prolonged_power
0:07.685 default P dimensional_rift Fluffy_Pillow 1034148.1/1100000: 94% mana | 3.0/5: 60% soul_shard bloodlust, berserking, soul_harvest, lord_of_flames, conflagration_of_chaos, accelerando, potion_of_prolonged_power
0:08.459 default Q chaos_bolt Fluffy_Pillow 1050748.6/1100000: 96% mana | 4.0/5: 80% soul_shard bloodlust, berserking, soul_harvest, lord_of_flames, conflagration_of_chaos, accelerando, potion_of_prolonged_power
0:10.002 default Q chaos_bolt Fluffy_Pillow 1083842.6/1100000: 99% mana | 3.0/5: 60% soul_shard bloodlust, berserking, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando, potion_of_prolonged_power
0:10.930 default K conflagrate Fluffy_Pillow 1100000.0/1100000: 100% mana | 2.0/5: 40% soul_shard bloodlust, berserking, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2), potion_of_prolonged_power
0:11.690 default Q chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard bloodlust, berserking, soul_harvest, lord_of_flames, embrace_chaos, accelerando(2), potion_of_prolonged_power
0:12.603 default K conflagrate Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard bloodlust, berserking, soul_harvest, lord_of_flames, embrace_chaos, accelerando, potion_of_prolonged_power
0:13.377 default K conflagrate Fluffy_Pillow 1100000.0/1100000: 100% mana | 2.0/5: 40% soul_shard bloodlust, berserking, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando, potion_of_prolonged_power
0:14.150 default Q chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 4.0/5: 80% soul_shard bloodlust, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando, potion_of_prolonged_power
0:15.216 default Q chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 2.0/5: 40% soul_shard bloodlust, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando, potion_of_prolonged_power
0:16.281 default R incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard bloodlust, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2), potion_of_prolonged_power
0:17.330 default R incinerate Fluffy_Pillow 1034076.8/1100000: 94% mana | 1.0/5: 20% soul_shard bloodlust, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3), potion_of_prolonged_power
0:18.365 default K conflagrate Fluffy_Pillow 987961.0/1100000: 90% mana | 1.0/5: 20% soul_shard bloodlust, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(4), potion_of_prolonged_power
0:19.216 default Q chaos_bolt Fluffy_Pillow 1004547.6/1100000: 91% mana | 3.0/5: 60% soul_shard bloodlust, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(4), potion_of_prolonged_power
0:20.237 default C havoc enemy2 1024447.6/1100000: 93% mana | 1.0/5: 20% soul_shard bloodlust, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(4), potion_of_prolonged_power
0:21.086 default Q chaos_bolt Fluffy_Pillow 952995.3/1100000: 87% mana | 2.0/5: 40% soul_shard bloodlust, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(4), potion_of_prolonged_power
0:22.106 default R incinerate Fluffy_Pillow 972875.8/1100000: 88% mana | 0.0/5: 0% soul_shard bloodlust, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(4), potion_of_prolonged_power
0:23.125 default R incinerate Fluffy_Pillow 926736.8/1100000: 84% mana | 0.0/5: 0% soul_shard bloodlust, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(4), potion_of_prolonged_power
0:24.145 default R incinerate Fluffy_Pillow 880617.3/1100000: 80% mana | 0.0/5: 0% soul_shard bloodlust, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(4), potion_of_prolonged_power
0:25.165 default R incinerate Fluffy_Pillow 833597.1/1100000: 76% mana | 0.0/5: 0% soul_shard bloodlust, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, potion_of_prolonged_power
0:26.246 default E immolate Fluffy_Pillow 787455.4/1100000: 72% mana | 0.0/5: 0% soul_shard bloodlust, lord_of_flames, conflagration_of_chaos, potion_of_prolonged_power
0:27.147 default R incinerate Fluffy_Pillow 738007.1/1100000: 67% mana | 0.0/5: 0% soul_shard bloodlust, lord_of_flames, conflagration_of_chaos, potion_of_prolonged_power
0:28.231 default R incinerate Fluffy_Pillow 691922.6/1100000: 63% mana | 0.0/5: 0% soul_shard bloodlust, lord_of_flames, conflagration_of_chaos, accelerando, potion_of_prolonged_power
0:29.296 default R incinerate Fluffy_Pillow 645785.1/1100000: 59% mana | 0.0/5: 0% soul_shard bloodlust, lord_of_flames, conflagration_of_chaos, accelerando, potion_of_prolonged_power
0:30.361 default R incinerate Fluffy_Pillow 599647.6/1100000: 55% mana | 0.0/5: 0% soul_shard bloodlust, lord_of_flames, conflagration_of_chaos, accelerando, potion_of_prolonged_power
0:31.428 default R incinerate Fluffy_Pillow 553547.4/1100000: 50% mana | 0.0/5: 0% soul_shard bloodlust, lord_of_flames, conflagration_of_chaos, accelerando, potion_of_prolonged_power
0:32.493 default G immolate Fluffy_Pillow 507409.9/1100000: 46% mana | 0.0/5: 0% soul_shard bloodlust, lord_of_flames, conflagration_of_chaos, accelerando, potion_of_prolonged_power
0:33.382 default J conflagrate Fluffy_Pillow 457991.4/1100000: 42% mana | 1.0/5: 20% soul_shard bloodlust, lord_of_flames, conflagration_of_chaos, accelerando(2), potion_of_prolonged_power
0:34.259 default K conflagrate Fluffy_Pillow 474593.5/1100000: 43% mana | 2.0/5: 40% soul_shard bloodlust, lord_of_flames, conflagration_of_chaos, accelerando(2), potion_of_prolonged_power
0:35.134 default Q chaos_bolt Fluffy_Pillow 491157.7/1100000: 45% mana | 3.0/5: 60% soul_shard bloodlust, lord_of_flames, conflagration_of_chaos, accelerando(2), potion_of_prolonged_power
0:36.882 default K conflagrate Fluffy_Pillow 524248.3/1100000: 48% mana | 1.0/5: 20% soul_shard bloodlust, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2), potion_of_prolonged_power
0:37.757 default Q chaos_bolt Fluffy_Pillow 540812.5/1100000: 49% mana | 2.0/5: 40% soul_shard bloodlust, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2), potion_of_prolonged_power
0:38.806 default K conflagrate Fluffy_Pillow 560670.6/1100000: 51% mana | 0.0/5: 0% soul_shard bloodlust, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2), potion_of_prolonged_power
0:39.682 default Q chaos_bolt Fluffy_Pillow 577253.7/1100000: 52% mana | 2.0/5: 40% soul_shard bloodlust, lord_of_flames, embrace_chaos, accelerando(2), potion_of_prolonged_power
0:40.731 default C havoc enemy2 596827.9/1100000: 54% mana | 1.0/5: 20% soul_shard bloodlust, lord_of_flames, embrace_chaos, potion_of_prolonged_power
0:41.634 default Q chaos_bolt Fluffy_Pillow 521588.2/1100000: 47% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, potion_of_prolonged_power
0:43.040 default R incinerate Fluffy_Pillow 541457.5/1100000: 49% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos, accelerando, potion_of_prolonged_power
0:44.426 default R incinerate Fluffy_Pillow 495341.5/1100000: 45% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos, accelerando, potion_of_prolonged_power
0:45.810 default K conflagrate Fluffy_Pillow 449197.7/1100000: 41% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos, accelerando(2), potion_of_prolonged_power
0:46.948 default P dimensional_rift Fluffy_Pillow 465769.2/1100000: 42% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2), potion_of_prolonged_power
0:48.087 default R incinerate Fluffy_Pillow 482355.3/1100000: 44% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, accelerando(2), potion_of_prolonged_power
0:49.450 default R incinerate Fluffy_Pillow 436474.5/1100000: 40% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, accelerando(3), potion_of_prolonged_power
0:50.795 default R incinerate Fluffy_Pillow 390349.9/1100000: 35% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, accelerando(3), potion_of_prolonged_power
0:52.137 default R incinerate Fluffy_Pillow 344181.0/1100000: 31% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, accelerando(3), potion_of_prolonged_power
0:53.480 default R incinerate Fluffy_Pillow 298026.8/1100000: 27% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, accelerando(3), potion_of_prolonged_power
0:54.823 default E immolate Fluffy_Pillow 251872.7/1100000: 23% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, accelerando(3), potion_of_prolonged_power
0:55.943 default R incinerate Fluffy_Pillow 201836.5/1100000: 18% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, potion_of_prolonged_power
0:57.348 default R incinerate Fluffy_Pillow 155813.5/1100000: 14% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, accelerando, potion_of_prolonged_power
0:58.732 default R incinerate Fluffy_Pillow 109669.7/1100000: 10% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, accelerando(2)
1:00.097 default S life_tap Fluffy_Pillow 63546.8/1100000: 6% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, accelerando(2)
1:01.234 default C havoc enemy2 410103.7/1100000: 37% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, accelerando(2)
1:02.373 default R incinerate Fluffy_Pillow 338904.0/1100000: 31% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, accelerando(3)
1:03.717 default G immolate Fluffy_Pillow 292764.6/1100000: 27% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, accelerando(3)
1:04.838 default J conflagrate Fluffy_Pillow 243329.9/1100000: 22% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, accelerando(3)
1:05.959 default K conflagrate Fluffy_Pillow 259920.5/1100000: 24% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, accelerando(4)
1:07.063 default Q chaos_bolt Fluffy_Pillow 276472.6/1100000: 25% mana | 3.0/5: 60% soul_shard lord_of_flames, accelerando(4)
1:09.268 default K conflagrate Fluffy_Pillow 309259.8/1100000: 28% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos
1:10.440 default Q chaos_bolt Fluffy_Pillow 325821.4/1100000: 30% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos
1:11.845 default K conflagrate Fluffy_Pillow 345675.5/1100000: 31% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos
1:13.074 default R incinerate Fluffy_Pillow 363042.5/1100000: 33% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, nefarious_pact
1:14.048 default R incinerate Fluffy_Pillow 310806.2/1100000: 28% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, nefarious_pact
1:15.023 default Q chaos_bolt Fluffy_Pillow 258583.9/1100000: 24% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, nefarious_pact
1:15.997 default R incinerate Fluffy_Pillow 272347.6/1100000: 25% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos, nefarious_pact
1:16.973 default R incinerate Fluffy_Pillow 220139.5/1100000: 20% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos, nefarious_pact
1:17.947 default R incinerate Fluffy_Pillow 168007.5/1100000: 15% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, nefarious_pact, accelerando
1:18.909 default K conflagrate Fluffy_Pillow 115808.7/1100000: 11% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, nefarious_pact, accelerando
1:19.709 default Q chaos_bolt Fluffy_Pillow 127285.8/1100000: 12% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando
1:20.669 default R incinerate Fluffy_Pillow 141257.7/1100000: 13% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(2)
1:21.617 default C havoc enemy2 89062.4/1100000: 8% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(2)
1:22.406 default Q chaos_bolt Fluffy_Pillow 12551.8/1100000: 1% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(2)
1:23.353 default S life_tap Fluffy_Pillow 26343.0/1100000: 2% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(3)
1:24.131 default R incinerate Fluffy_Pillow 367839.7/1100000: 33% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(3)
1:25.065 default R incinerate Fluffy_Pillow 315641.7/1100000: 29% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due, accelerando(3)
1:26.648 default E immolate Fluffy_Pillow 273034.1/1100000: 25% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due, accelerando(3)
1:27.968 default R incinerate Fluffy_Pillow 226540.1/1100000: 21% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, devils_due, accelerando(3)
1:29.551 default R incinerate Fluffy_Pillow 183874.9/1100000: 17% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, devils_due
1:31.206 default P dimensional_rift Fluffy_Pillow 141387.8/1100000: 13% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, devils_due, accelerando
1:32.564 default Q chaos_bolt Fluffy_Pillow 160870.1/1100000: 15% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, devils_due, accelerando
1:35.278 default L service_imp Fluffy_Pillow 199806.1/1100000: 18% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
1:36.434 default R incinerate Fluffy_Pillow 216390.5/1100000: 20% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
1:37.819 default G immolate Fluffy_Pillow 170260.2/1100000: 15% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
1:38.973 default J conflagrate Fluffy_Pillow 120815.8/1100000: 11% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos, accelerando
1:40.128 default K conflagrate Fluffy_Pillow 137385.9/1100000: 12% mana | 1.0/5: 20% soul_shard lord_of_flames, accelerando
1:41.280 default Q chaos_bolt Fluffy_Pillow 154161.2/1100000: 14% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, accelerando(2)
1:43.551 default C havoc enemy2 186848.6/1100000: 17% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
1:44.724 default K conflagrate Fluffy_Pillow 115424.3/1100000: 10% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
1:45.895 default Q chaos_bolt Fluffy_Pillow 132223.8/1100000: 12% mana | 5.0/5: 100% soul_shard lord_of_flames, embrace_chaos, accelerando
1:47.280 default Q chaos_bolt Fluffy_Pillow 152131.5/1100000: 14% mana | 3.0/5: 60% soul_shard lord_of_flames, embrace_chaos, accelerando(2)
1:48.641 default K conflagrate Fluffy_Pillow 171950.7/1100000: 16% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando(3)
1:49.761 default Q chaos_bolt Fluffy_Pillow 188501.2/1100000: 17% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando(3)
1:51.105 default R incinerate Fluffy_Pillow 208362.9/1100000: 19% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando(4)
1:52.431 default Q chaos_bolt Fluffy_Pillow 162244.8/1100000: 15% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando(5)
1:53.737 default K conflagrate Fluffy_Pillow 182106.6/1100000: 17% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos, accelerando(5)
1:54.825 default R incinerate Fluffy_Pillow 198653.1/1100000: 18% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando(5)
1:56.131 default R incinerate Fluffy_Pillow 152514.9/1100000: 14% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando(5)
1:57.438 default R incinerate Fluffy_Pillow 105622.9/1100000: 10% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos
1:58.842 default S life_tap Fluffy_Pillow 59698.8/1100000: 5% mana | 1.0/5: 20% soul_shard lord_of_flames, accelerando(2)
1:59.979 default R incinerate Fluffy_Pillow 406255.7/1100000: 37% mana | 1.0/5: 20% soul_shard lord_of_flames, accelerando(2)
2:01.341 default E immolate Fluffy_Pillow 360089.1/1100000: 33% mana | 3.0/5: 60% soul_shard lord_of_flames, accelerando(2)
2:02.478 default Q chaos_bolt Fluffy_Pillow 310669.5/1100000: 28% mana | 4.0/5: 80% soul_shard lord_of_flames, accelerando(3)
2:04.716 default C havoc enemy2 343741.0/1100000: 31% mana | 3.0/5: 60% soul_shard lord_of_flames, embrace_chaos, accelerando(3)
2:05.838 default Q chaos_bolt Fluffy_Pillow 272321.1/1100000: 25% mana | 3.0/5: 60% soul_shard lord_of_flames, embrace_chaos, accelerando(3)
2:07.182 default O soul_harvest Fluffy_Pillow 292233.9/1100000: 27% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando(4)
2:07.182 default I potion Fluffy_Pillow 292233.9/1100000: 27% mana | 2.0/5: 40% soul_shard soul_harvest, lord_of_flames, embrace_chaos, accelerando(4)
2:07.182 default Q chaos_bolt Fluffy_Pillow 292233.9/1100000: 27% mana | 2.0/5: 40% soul_shard soul_harvest, lord_of_flames, embrace_chaos, accelerando(4), potion_of_deadly_grace
2:08.506 default R incinerate Fluffy_Pillow 312085.3/1100000: 28% mana | 0.0/5: 0% soul_shard soul_harvest, lord_of_flames, embrace_chaos, accelerando(5), potion_of_deadly_grace
2:09.812 default Q chaos_bolt Fluffy_Pillow 265947.2/1100000: 24% mana | 2.0/5: 40% soul_shard soul_harvest, lord_of_flames, embrace_chaos, accelerando(5), potion_of_deadly_grace
2:11.118 default G immolate Fluffy_Pillow 284795.4/1100000: 26% mana | 0.0/5: 0% soul_shard soul_harvest, lord_of_flames, embrace_chaos, accelerando, potion_of_deadly_grace
2:12.271 default J conflagrate Fluffy_Pillow 235336.8/1100000: 21% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, embrace_chaos, accelerando, potion_of_deadly_grace
2:13.426 default K conflagrate Fluffy_Pillow 251906.8/1100000: 23% mana | 2.0/5: 40% soul_shard soul_harvest, lord_of_flames, embrace_chaos, accelerando, potion_of_deadly_grace
2:14.580 default Q chaos_bolt Fluffy_Pillow 268462.5/1100000: 24% mana | 3.0/5: 60% soul_shard soul_harvest, lord_of_flames, embrace_chaos, accelerando, potion_of_deadly_grace
2:15.963 default P dimensional_rift Fluffy_Pillow 288303.5/1100000: 26% mana | 3.0/5: 60% soul_shard soul_harvest, lord_of_flames, embrace_chaos, accelerando, potion_of_deadly_grace
2:17.308 default Q chaos_bolt Fluffy_Pillow 307599.3/1100000: 28% mana | 3.0/5: 60% soul_shard soul_harvest, lord_of_flames, embrace_chaos, accelerando, potion_of_deadly_grace
2:18.691 default K conflagrate Fluffy_Pillow 327544.0/1100000: 30% mana | 2.0/5: 40% soul_shard soul_harvest, lord_of_flames, embrace_chaos, accelerando(2), potion_of_deadly_grace
2:19.829 default Q chaos_bolt Fluffy_Pillow 344115.5/1100000: 31% mana | 3.0/5: 60% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2), potion_of_deadly_grace
2:21.192 default K conflagrate Fluffy_Pillow 364110.7/1100000: 33% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3), potion_of_deadly_grace
2:22.311 default Q chaos_bolt Fluffy_Pillow 380646.5/1100000: 35% mana | 2.0/5: 40% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3), potion_of_deadly_grace
2:23.655 default R incinerate Fluffy_Pillow 400236.6/1100000: 36% mana | 0.0/5: 0% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, potion_of_deadly_grace
2:25.061 default C havoc enemy2 354104.9/1100000: 32% mana | 0.0/5: 0% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, potion_of_deadly_grace
2:26.232 default R incinerate Fluffy_Pillow 282652.3/1100000: 26% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, potion_of_deadly_grace
2:27.638 default K conflagrate Fluffy_Pillow 236521.6/1100000: 22% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando, potion_of_deadly_grace
2:28.793 default Q chaos_bolt Fluffy_Pillow 253091.7/1100000: 23% mana | 2.0/5: 40% soul_shard lord_of_flames, accelerando, potion_of_deadly_grace
2:31.098 default R incinerate Fluffy_Pillow 286161.1/1100000: 26% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos, accelerando(2), potion_of_deadly_grace
2:32.461 default R incinerate Fluffy_Pillow 240009.0/1100000: 22% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos, accelerando(2), potion_of_deadly_grace
2:33.824 default E immolate Fluffy_Pillow 193856.9/1100000: 18% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos, accelerando(2), potion_of_deadly_grace
2:34.962 default R incinerate Fluffy_Pillow 144428.4/1100000: 13% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos, accelerando(2), potion_of_deadly_grace
2:36.326 default R incinerate Fluffy_Pillow 98290.9/1100000: 9% mana | 1.0/5: 20% soul_shard lord_of_flames, accelerando(2), potion_of_deadly_grace
2:37.689 default S life_tap Fluffy_Pillow 52138.9/1100000: 5% mana | 1.0/5: 20% soul_shard lord_of_flames, accelerando(2)
2:38.826 default R incinerate Fluffy_Pillow 398695.8/1100000: 36% mana | 1.0/5: 20% soul_shard lord_of_flames, accelerando(2)
2:40.191 default R incinerate Fluffy_Pillow 352333.7/1100000: 32% mana | 1.0/5: 20% soul_shard lord_of_flames, accelerando
2:41.575 default Q chaos_bolt Fluffy_Pillow 306189.0/1100000: 28% mana | 2.0/5: 40% soul_shard lord_of_flames, accelerando
2:43.878 default R incinerate Fluffy_Pillow 339228.7/1100000: 31% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos, accelerando
2:45.263 default C havoc enemy2 293198.2/1100000: 27% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando(2)
2:46.398 default G immolate Fluffy_Pillow 221726.0/1100000: 20% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando(2)
2:47.534 default J conflagrate Fluffy_Pillow 172369.1/1100000: 16% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando(3)
2:48.655 default K conflagrate Fluffy_Pillow 188934.4/1100000: 17% mana | 2.0/5: 40% soul_shard lord_of_flames, accelerando(3)
2:49.774 default Q chaos_bolt Fluffy_Pillow 205470.2/1100000: 19% mana | 4.0/5: 80% soul_shard lord_of_flames, conflagration_of_chaos, accelerando(3)
2:52.012 default K conflagrate Fluffy_Pillow 238638.0/1100000: 22% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(4)
2:53.114 default Q chaos_bolt Fluffy_Pillow 254359.5/1100000: 23% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
2:54.519 default K conflagrate Fluffy_Pillow 274375.6/1100000: 25% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
2:55.673 default Q chaos_bolt Fluffy_Pillow 290931.3/1100000: 26% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
2:57.058 default R incinerate Fluffy_Pillow 311007.9/1100000: 28% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
2:58.421 default R incinerate Fluffy_Pillow 264855.9/1100000: 24% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
2:59.784 default R incinerate Fluffy_Pillow 218703.8/1100000: 20% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
3:01.147 default K conflagrate Fluffy_Pillow 172551.7/1100000: 16% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, accelerando(2)
3:02.308 default P dimensional_rift Fluffy_Pillow 189458.1/1100000: 17% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, accelerando(2)
3:03.445 default Q chaos_bolt Fluffy_Pillow 206126.0/1100000: 19% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, accelerando(3)
3:05.683 default C havoc enemy2 239310.0/1100000: 22% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(5)
3:06.772 default H berserking Fluffy_Pillow 166789.2/1100000: 15% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
3:06.772 default L service_imp Fluffy_Pillow 166789.2/1100000: 15% mana | 1.0/5: 20% soul_shard berserking, lord_of_flames, conflagration_of_chaos, embrace_chaos
3:07.792 default R incinerate Fluffy_Pillow 183462.7/1100000: 17% mana | 0.0/5: 0% soul_shard berserking, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
3:08.998 default E immolate Fluffy_Pillow 137359.6/1100000: 12% mana | 0.0/5: 0% soul_shard berserking, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
3:10.005 default R incinerate Fluffy_Pillow 87973.4/1100000: 8% mana | 0.0/5: 0% soul_shard berserking, lord_of_flames, conflagration_of_chaos, accelerando
3:11.208 default S life_tap Fluffy_Pillow 41820.9/1100000: 4% mana | 0.0/5: 0% soul_shard berserking, lord_of_flames, conflagration_of_chaos, accelerando
3:12.214 default R incinerate Fluffy_Pillow 388418.2/1100000: 35% mana | 0.0/5: 0% soul_shard berserking, lord_of_flames, conflagration_of_chaos, accelerando
3:13.421 default R incinerate Fluffy_Pillow 342454.8/1100000: 31% mana | 0.0/5: 0% soul_shard berserking, lord_of_flames, conflagration_of_chaos, accelerando(3)
3:14.590 default R incinerate Fluffy_Pillow 296320.6/1100000: 27% mana | 0.0/5: 0% soul_shard berserking, lord_of_flames, conflagration_of_chaos, accelerando(3)
3:15.760 default R incinerate Fluffy_Pillow 250203.4/1100000: 23% mana | 1.0/5: 20% soul_shard berserking, lord_of_flames, conflagration_of_chaos, accelerando(3)
3:16.930 default R incinerate Fluffy_Pillow 203736.0/1100000: 19% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, accelerando(3)
3:18.274 default G immolate Fluffy_Pillow 157597.7/1100000: 14% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, accelerando(4)
3:19.380 default J conflagrate Fluffy_Pillow 108245.5/1100000: 10% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, accelerando(5)
3:20.469 default K conflagrate Fluffy_Pillow 123652.5/1100000: 11% mana | 2.0/5: 40% soul_shard lord_of_flames
3:21.640 default Q chaos_bolt Fluffy_Pillow 140199.9/1100000: 13% mana | 4.0/5: 80% soul_shard lord_of_flames, conflagration_of_chaos
3:23.980 default K conflagrate Fluffy_Pillow 173266.6/1100000: 16% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
3:25.152 default Q chaos_bolt Fluffy_Pillow 189828.1/1100000: 17% mana | 3.0/5: 60% soul_shard lord_of_flames, embrace_chaos
3:26.558 default C havoc enemy2 209828.6/1100000: 19% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando
3:27.711 default K conflagrate Fluffy_Pillow 138369.9/1100000: 13% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando
3:28.866 default Q chaos_bolt Fluffy_Pillow 154940.0/1100000: 14% mana | 3.0/5: 60% soul_shard lord_of_flames, embrace_chaos, nefarious_pact, accelerando
3:29.824 default Q chaos_bolt Fluffy_Pillow 168683.8/1100000: 15% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, nefarious_pact, accelerando
3:30.783 default R incinerate Fluffy_Pillow 182441.9/1100000: 17% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, nefarious_pact, accelerando
3:31.743 default P dimensional_rift Fluffy_Pillow 130214.4/1100000: 12% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, nefarious_pact, accelerando
3:32.544 default R incinerate Fluffy_Pillow 141705.8/1100000: 13% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, nefarious_pact, accelerando
3:33.504 default K conflagrate Fluffy_Pillow 89478.3/1100000: 8% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, nefarious_pact, accelerando
3:34.305 default Q chaos_bolt Fluffy_Pillow 100969.7/1100000: 9% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando
3:35.263 default Q chaos_bolt Fluffy_Pillow 114713.5/1100000: 10% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando
3:36.220 default R incinerate Fluffy_Pillow 128443.4/1100000: 12% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(2)
3:37.167 default R incinerate Fluffy_Pillow 76233.6/1100000: 7% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(2)
3:38.113 default S life_tap Fluffy_Pillow 23936.4/1100000: 2% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact
3:38.926 default R incinerate Fluffy_Pillow 365424.9/1100000: 33% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact
3:39.902 default R incinerate Fluffy_Pillow 313218.1/1100000: 28% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando
3:40.863 default R incinerate Fluffy_Pillow 261004.9/1100000: 24% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, devils_due, accelerando
3:42.493 default E immolate Fluffy_Pillow 218389.5/1100000: 20% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, devils_due, accelerando
3:43.854 default R incinerate Fluffy_Pillow 171916.1/1100000: 16% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, devils_due, accelerando(2)
3:45.459 default R incinerate Fluffy_Pillow 129288.1/1100000: 12% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, devils_due, accelerando(2)
3:47.065 default P dimensional_rift Fluffy_Pillow 86674.5/1100000: 8% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, devils_due, accelerando(2)
3:48.405 default C havoc enemy2 106187.6/1100000: 10% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, accelerando(2)
3:49.544 default Q chaos_bolt Fluffy_Pillow 34773.6/1100000: 3% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, accelerando(2)
3:51.814 default G immolate Fluffy_Pillow 67829.2/1100000: 6% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
3:52.953 default J conflagrate Fluffy_Pillow 17961.1/1100000: 2% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
3:54.109 default K conflagrate Fluffy_Pillow 34545.5/1100000: 3% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
3:55.263 default K conflagrate Fluffy_Pillow 51350.0/1100000: 5% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando(2)
3:56.401 default N summon_doomguard Fluffy_Pillow 67994.9/1100000: 6% mana | 3.0/5: 60% soul_shard lord_of_flames, accelerando(3)
3:57.523 default Q chaos_bolt Fluffy_Pillow 84575.0/1100000: 8% mana | 2.0/5: 40% soul_shard lord_of_flames, accelerando(3)
3:59.759 default R incinerate Fluffy_Pillow 117616.9/1100000: 11% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos, accelerando(3)
4:01.102 default K conflagrate Fluffy_Pillow 71462.8/1100000: 6% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando(3)
4:02.223 default Q chaos_bolt Fluffy_Pillow 88028.1/1100000: 8% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
4:03.566 default R incinerate Fluffy_Pillow 107873.9/1100000: 10% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(3)
4:04.499 default S life_tap Fluffy_Pillow 55695.6/1100000: 5% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(4)
4:05.267 default R incinerate Fluffy_Pillow 396934.3/1100000: 36% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact
4:06.241 default Q chaos_bolt Fluffy_Pillow 344697.9/1100000: 31% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact
4:07.216 default O soul_harvest Fluffy_Pillow 358475.7/1100000: 33% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact
4:07.216 default R incinerate Fluffy_Pillow 358475.7/1100000: 33% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact
4:08.190 default K conflagrate Fluffy_Pillow 306239.3/1100000: 28% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact
4:09.002 default C havoc enemy2 317713.7/1100000: 29% mana | 2.0/5: 40% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact
4:09.815 default Q chaos_bolt Fluffy_Pillow 241377.3/1100000: 22% mana | 2.0/5: 40% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando
4:10.776 default R incinerate Fluffy_Pillow 255378.9/1100000: 23% mana | 0.0/5: 0% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(3)
4:11.708 default R incinerate Fluffy_Pillow 203151.3/1100000: 18% mana | 0.0/5: 0% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(3)
4:12.641 default R incinerate Fluffy_Pillow 150938.5/1100000: 14% mana | 0.0/5: 0% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(3)
4:13.574 default R incinerate Fluffy_Pillow 98725.6/1100000: 9% mana | 0.0/5: 0% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(3)
4:14.506 default S life_tap Fluffy_Pillow 46498.9/1100000: 4% mana | 0.0/5: 0% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(4)
4:15.272 default E immolate Fluffy_Pillow 387983.4/1100000: 35% mana | 0.0/5: 0% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, devils_due, accelerando(4)
4:16.573 default R incinerate Fluffy_Pillow 341489.1/1100000: 31% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, devils_due, accelerando(4)
4:18.135 default R incinerate Fluffy_Pillow 298909.3/1100000: 27% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, devils_due, accelerando(5)
4:19.674 default R incinerate Fluffy_Pillow 256314.6/1100000: 23% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, devils_due, accelerando(5)
4:21.213 default R incinerate Fluffy_Pillow 213492.7/1100000: 19% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, devils_due
4:22.869 default R incinerate Fluffy_Pillow 170893.7/1100000: 16% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos
4:24.277 default R incinerate Fluffy_Pillow 124790.2/1100000: 11% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos
4:25.681 default G immolate Fluffy_Pillow 78630.2/1100000: 7% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos
4:26.852 default J conflagrate Fluffy_Pillow 29177.6/1100000: 3% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos
4:28.025 default Q chaos_bolt Fluffy_Pillow 45753.3/1100000: 4% mana | 3.0/5: 60% soul_shard lord_of_flames
4:30.365 default K conflagrate Fluffy_Pillow 79084.2/1100000: 7% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando
4:31.518 default C havoc enemy2 95625.5/1100000: 9% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
4:32.673 default K conflagrate Fluffy_Pillow 24195.5/1100000: 2% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
4:33.828 default P dimensional_rift Fluffy_Pillow 40765.6/1100000: 4% mana | 4.0/5: 80% soul_shard lord_of_flames, embrace_chaos, accelerando
4:34.983 default Q chaos_bolt Fluffy_Pillow 57335.6/1100000: 5% mana | 4.0/5: 80% soul_shard lord_of_flames, accelerando
4:37.288 default J conflagrate Fluffy_Pillow 90673.4/1100000: 8% mana | 4.0/5: 80% soul_shard lord_of_flames, embrace_chaos, accelerando(2)
4:38.425 default L service_imp Fluffy_Pillow 107230.4/1100000: 10% mana | 5.0/5: 100% soul_shard lord_of_flames, embrace_chaos, accelerando(2)
4:39.563 default Q chaos_bolt Fluffy_Pillow 123801.9/1100000: 11% mana | 4.0/5: 80% soul_shard lord_of_flames, embrace_chaos, accelerando(2)
4:40.925 default Q chaos_bolt Fluffy_Pillow 143635.2/1100000: 13% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando(2)
4:42.290 default J conflagrate Fluffy_Pillow 163017.2/1100000: 15% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos, accelerando
4:43.445 default R incinerate Fluffy_Pillow 179587.2/1100000: 16% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando
4:44.830 default R incinerate Fluffy_Pillow 133458.0/1100000: 12% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando(2)
4:46.196 default Q chaos_bolt Fluffy_Pillow 87349.6/1100000: 8% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando(2)
4:47.560 default R incinerate Fluffy_Pillow 107238.8/1100000: 10% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos, accelerando(3)
4:48.904 default J conflagrate Fluffy_Pillow 61099.4/1100000: 6% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos, accelerando(3)
4:50.026 default E immolate Fluffy_Pillow 77749.3/1100000: 7% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando(4)
4:51.132 default S life_tap Fluffy_Pillow 28332.7/1100000: 3% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando(5)
4:52.220 default C havoc enemy2 374879.2/1100000: 34% mana | 1.0/5: 20% soul_shard lord_of_flames, accelerando(5)
4:53.307 default R incinerate Fluffy_Pillow 303410.5/1100000: 28% mana | 1.0/5: 20% soul_shard lord_of_flames, accelerando(5)
4:54.613 default Q chaos_bolt Fluffy_Pillow 256918.0/1100000: 23% mana | 2.0/5: 40% soul_shard lord_of_flames
4:56.952 default J conflagrate Fluffy_Pillow 289970.5/1100000: 26% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos
4:58.124 default R incinerate Fluffy_Pillow 306595.1/1100000: 28% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
4:59.508 default R incinerate Fluffy_Pillow 260450.5/1100000: 24% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
5:00.891 default R incinerate Fluffy_Pillow 214291.5/1100000: 19% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4201 3876 0
Agility 7254 6929 0
Stamina 52586 52586 34192
Intellect 50353 48647 39007 (1278)
Spirit 1 1 0
Health 3155160 3155160 0
Mana 1100000 1100000 0
Soul Shard 5 5 0
Spell Power 50353 48647 0
Crit 15.68% 15.68% 4271
Haste 28.46% 27.46% 10299
Damage / Heal Versatility 5.36% 5.36% 2544
ManaReg per Second 14131 14021 0
Mastery 69.03% 69.03% 6003
Armor 1975 1975 1975
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 906.00
Local Head Eyes of Azj'Aqir
ilevel: 900, stats: { 253 Armor, +3255 Sta, +2170 Int, +1074 Haste, +578 Vers }
Local Neck Radiant String of Scorpid Eyes
ilevel: 900, stats: { +1831 Sta, +2011 Haste, +922 Crit }, enchant: mark_of_the_hidden_satyr
Local Shoulders Pauldrons of Azj'Aqir
ilevel: 900, stats: { 233 Armor, +2442 Sta, +1628 Int, +752 Mastery, +487 Vers }
Local Chest Robes of Fluctuating Energy
ilevel: 900, stats: { 311 Armor, +3255 Sta, +2170 Int, +1145 Haste, +507 Mastery }
Local Waist Man'ari Skullbuckled Cinch
ilevel: 900, stats: { 175 Armor, +2442 Sta, +1628 Int, +699 Haste, +540 Mastery }
Local Legs Leggings of Azj'Aqir
ilevel: 900, stats: { 272 Armor, +3255 Sta, +2170 Int, +932 Crit, +720 Haste }
Local Feet Outcast Wanderer's Footrags
ilevel: 910, stats: { 222 Armor, +2680 Sta, +1786 Int, +864 Crit, +422 Mastery }
Local Wrists Magistrike Restraints
ilevel: 940, stats: { 157 Armor, +2658 Sta, +1772 Int, +694 Crit, +385 Mastery }
Local Hands Clutch of Azj'Aqir
ilevel: 900, stats: { 194 Armor, +2442 Sta, +1628 Int, +859 Crit, +380 Mastery }
Local Finger1 Ring of the Scoured Clan
ilevel: 900, stats: { +1831 Sta, +2095 Mastery, +838 Haste }, enchant: { +200 Haste }
Local Finger2 Ring of Braided Stems
ilevel: 905, stats: { +1918 Sta, +1814 Haste, +1209 Vers }, enchant: { +200 Haste }
Local Trinket1 Whispers in the Dark
ilevel: 905, stats: { +2162 Int }
Local Trinket2 Erratic Metronome
ilevel: 900, stats: { +2063 Int }
Local Back Astromancer's Greatcloak
ilevel: 905, stats: { 158 Armor, +1918 Sta, +1278 StrAgiInt, +676 Haste, +270 Vers }, enchant: { +200 Int }
Local Main Hand Scepter of Sargeras
ilevel: 929, weapon: { 7005 - 10509, 3.6 }, stats: { +2843 Int, +4265 Sta, +922 Haste, +922 Mastery, +15509 Int }, relics: { +61 ilevels, +59 ilevels, +61 ilevels }

Talents

Level
15 Backdraft (Destruction Warlock) Roaring Blaze (Destruction Warlock) Shadowburn (Destruction Warlock)
30 Reverse Entropy (Destruction Warlock) Eradication (Destruction Warlock) Empowered Life Tap
45 Demonic Circle Mortal Coil Shadowfury
60 Cataclysm (Destruction Warlock) Fire and Brimstone (Destruction Warlock) Soul Harvest
75 Demon Skin Burning Rush Dark Pact
90 Grimoire of Supremacy Grimoire of Service Grimoire of Sacrifice
100 Wreak Havoc (Destruction Warlock) Channel Demonfire (Destruction Warlock) Soul Conduit

Profile

warlock="Magistrike"
level=110
race=troll
role=spell
position=back
talents=2203021
artifact=38:142513:142516:142513:0:803:1:804:3:805:3:806:5:807:3:808:3:809:4:810:3:811:3:812:3:813:1:814:1:815:1:816:1:817:1:818:1:1355:1
spec=destruction

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,type=whispered_pact
actions.precombat+=/food,type=azshari_salad
actions.precombat+=/summon_pet,if=!talent.grimoire_of_supremacy.enabled&(!talent.grimoire_of_sacrifice.enabled|buff.demonic_power.down)
actions.precombat+=/summon_infernal,if=talent.grimoire_of_supremacy.enabled&artifact.lord_of_flames.rank>0
actions.precombat+=/summon_infernal,if=talent.grimoire_of_supremacy.enabled&active_enemies>1
actions.precombat+=/summon_doomguard,if=talent.grimoire_of_supremacy.enabled&active_enemies=1&artifact.lord_of_flames.rank=0
actions.precombat+=/augmentation,type=defiled
actions.precombat+=/snapshot_stats
actions.precombat+=/grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
actions.precombat+=/life_tap,if=talent.empowered_life_tap.enabled&!buff.empowered_life_tap.remains
actions.precombat+=/potion,name=prolonged_power
actions.precombat+=/chaos_bolt

# Executed every time the actor is available.
actions=havoc,target=2,if=active_enemies>1&(active_enemies<4|talent.wreak_havoc.enabled&active_enemies<6)&!debuff.havoc.remains
actions+=/dimensional_rift,if=charges=3
actions+=/immolate,if=remains<=tick_time
actions+=/immolate,cycle_targets=1,if=active_enemies>1&remains<=tick_time&(!talent.roaring_blaze.enabled|(!debuff.roaring_blaze.remains&action.conflagrate.charges<2))
actions+=/immolate,if=talent.roaring_blaze.enabled&remains<=duration&!debuff.roaring_blaze.remains&target.time_to_die>10&(action.conflagrate.charges=2+set_bonus.tier19_4pc|(action.conflagrate.charges>=1+set_bonus.tier19_4pc&action.conflagrate.recharge_time<cast_time+gcd)|target.time_to_die<24)
actions+=/berserking
actions+=/blood_fury
actions+=/arcane_torrent
actions+=/potion,name=deadly_grace,if=(buff.soul_harvest.remains|trinket.proc.any.react|target.time_to_die<=45)
actions+=/shadowburn,if=buff.conflagration_of_chaos.remains<=action.chaos_bolt.cast_time
actions+=/shadowburn,if=(charges=1&recharge_time<action.chaos_bolt.cast_time|charges=2)&soul_shard<5
actions+=/conflagrate,if=talent.roaring_blaze.enabled&(charges=2+set_bonus.tier19_4pc|(charges>=1+set_bonus.tier19_4pc&recharge_time<gcd)|target.time_to_die<24)
actions+=/conflagrate,if=talent.roaring_blaze.enabled&debuff.roaring_blaze.stack>0&dot.immolate.remains>dot.immolate.duration*0.3&(active_enemies=1|soul_shard<3)&soul_shard<5
actions+=/conflagrate,if=!talent.roaring_blaze.enabled&!buff.backdraft.remains&buff.conflagration_of_chaos.remains<=action.chaos_bolt.cast_time
actions+=/conflagrate,if=!talent.roaring_blaze.enabled&!buff.backdraft.remains&(charges=1&recharge_time<action.chaos_bolt.cast_time|charges=2)&soul_shard<5
actions+=/life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<=gcd
actions+=/dimensional_rift,if=equipped.144369&!buff.lessons_of_spacetime.remains&((!talent.grimoire_of_supremacy.enabled&!cooldown.summon_doomguard.remains)|(talent.grimoire_of_service.enabled&!cooldown.service_pet.remains)|(talent.soul_harvest.enabled&!cooldown.soul_harvest.remains))
actions+=/service_pet
actions+=/summon_infernal,if=artifact.lord_of_flames.rank>0&!buff.lord_of_flames.remains
actions+=/summon_doomguard,if=!talent.grimoire_of_supremacy.enabled&spell_targets.infernal_awakening<=2&(target.time_to_die>180|target.health.pct<=20|target.time_to_die<30)
actions+=/summon_infernal,if=!talent.grimoire_of_supremacy.enabled&spell_targets.infernal_awakening>2
actions+=/summon_doomguard,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal=1&artifact.lord_of_flames.rank>0&buff.lord_of_flames.remains&!pet.doomguard.active
actions+=/summon_doomguard,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal=1&equipped.132379&!cooldown.sindorei_spite_icd.remains
actions+=/summon_infernal,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal>1&equipped.132379&!cooldown.sindorei_spite_icd.remains
actions+=/soul_harvest
actions+=/channel_demonfire,if=dot.immolate.remains>cast_time
actions+=/havoc,if=active_enemies=1&talent.wreak_havoc.enabled&equipped.132375&!debuff.havoc.remains
actions+=/rain_of_fire,if=active_enemies>=3&cooldown.havoc.remains<=12&!talent.wreak_havoc.enabled
actions+=/rain_of_fire,if=active_enemies>=6&talent.wreak_havoc.enabled
actions+=/dimensional_rift,if=!equipped.144369|charges>1|((!talent.grimoire_of_service.enabled|recharge_time<cooldown.service_pet.remains)&(!talent.soul_harvest.enabled|recharge_time<cooldown.soul_harvest.remains)&(!talent.grimoire_of_supremacy.enabled|recharge_time<cooldown.summon_doomguard.remains))
actions+=/life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<duration*0.3
actions+=/cataclysm
actions+=/chaos_bolt,if=(cooldown.havoc.remains>12&cooldown.havoc.remains|active_enemies<3|talent.wreak_havoc.enabled&active_enemies<6)
actions+=/shadowburn
actions+=/conflagrate,if=!talent.roaring_blaze.enabled&!buff.backdraft.remains
actions+=/immolate,if=!talent.roaring_blaze.enabled&remains<=duration*0.3
actions+=/incinerate
actions+=/life_tap

head=eyes_of_azjaqir,id=138314,bonus_id=3445
neck=radiant_string_of_scorpid_eyes,id=140898,bonus_id=3445,enchant_id=5439
shoulders=pauldrons_of_azjaqir,id=138323,bonus_id=3445
back=astromancers_greatcloak,id=140909,bonus_id=3518,enchant_id=5436
chest=robes_of_fluctuating_energy,id=140848,bonus_id=3445
wrists=magistrike_restraints,id=132407,ilevel=940
hands=clutch_of_azjaqir,id=138311,bonus_id=3445
waist=manari_skullbuckled_cinch,id=140887,bonus_id=3445
legs=leggings_of_azjaqir,id=138317,bonus_id=3445
feet=outcast_wanderers_footrags,id=140914,bonus_id=3519
finger1=ring_of_the_scoured_clan,id=140897,bonus_id=3445,enchant=binding_of_haste
finger2=ring_of_braided_stems,id=140896,bonus_id=3518,enchant=binding_of_haste
trinket1=whispers_in_the_dark,id=140809,ilevel=905
trinket2=erratic_metronome,id=140792,ilevel=900
main_hand=scepter_of_sargeras,id=128941,ilevel=929,gem_id=140826/140837/140826,relic_id=3519/3518:3518/3519

# Gear Summary
# gear_ilvl=906.27
# gear_stamina=34192
# gear_intellect=39007
# gear_crit_rating=4271
# gear_haste_rating=10299
# gear_mastery_rating=6003
# gear_versatility_rating=2544
# gear_armor=1975
# set_bonus=tier19_2pc=1
# set_bonus=tier19_4pc=1
default_pet=imp

Norgannon's : 985056 dps, 576189 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
985055.8 985055.8 0.0 / 0.000% 0.0 / 0.0% 29.9
RPS Out RPS In Primary Resource Waiting APM Active Skill
27028.3 27028.3 Mana 0.00% 51.6 100.0% 100%
Talents
  • 15: Roaring Blaze (Destruction Warlock)
  • 30: Eradication (Destruction Warlock)
  • 60: Soul Harvest
  • 90: Grimoire of Service
  • 100: Wreak Havoc (Destruction Warlock)
  • Talent Calculator
Artifact

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Norgannon's 985056
Chaos Bolt 315239 32.0% 57.9 5.05sec 1636047 1099872 Direct 111.4 0 850986 850986 100.0%  

Stats details: chaos_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 57.94 111.39 0.00 0.00 1.4875 0.0000 94789139.00 94789139.00 0.00 1099871.66 1099871.66
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 111.39 100.00% 850986.00 555032 1315283 851266.29 798625 922741 94789139 94789139 0.00
 
 

Action details: chaos_bolt

Static Values
  • id:116858
  • school:chromatic
  • resource:soul_shard
  • range:40.0
  • travel_speed:16.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:2.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:116858
  • name:Chaos Bolt
  • school:chromatic
  • tooltip:
  • description:Unleashes a devastating blast of chaos, causing {$s1=1} Chaos damage. Chaos Bolt always critically strikes and your critical strike chance increases its damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:4.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Conflagrate 106837 10.9% 49.2 6.10sec 652448 639719 Direct 97.7 198331 438907 328447 54.1%  

Stats details: conflagrate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 49.21 97.75 0.00 0.00 1.0199 0.0000 32104282.18 32104282.18 0.00 639718.68 639718.68
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 44.88 45.92% 198331.15 130801 309955 198413.14 177991 220798 8901372 8901372 0.00
crit 52.87 54.08% 438906.85 261662 692970 439028.55 396983 499090 23202910 23202910 0.00
 
 

Action details: conflagrate

Static Values
  • id:17962
  • school:fire
  • resource:chi
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:9.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.roaring_blaze.enabled&(charges=2+set_bonus.tier19_4pc|(charges>=1+set_bonus.tier19_4pc&recharge_time<gcd)|target.time_to_die<24)
Spelldata
  • id:17962
  • name:Conflagrate
  • school:fire
  • tooltip:
  • description:Triggers an explosion on the target, dealing {$s1=1} Fire damage.{$?s196406=false}[ Reduces the cast time of Incinerate and Chaos Bolt by {$117828s1=30}% for {$117828d=10 seconds}.][] |cFFFFFFFFGenerates 1 Soul Shard.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.265510
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Deadly Grace 5213 0.5% 14.6 2.04sec 105707 0 Direct 14.6 94545 189015 105706 11.8%  

Stats details: deadly_grace

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.56 14.56 0.00 0.00 0.0000 0.0000 1538834.50 1538834.50 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 12.84 88.19% 94545.01 83888 100666 94555.08 88083 100666 1213738 1213738 0.00
crit 1.72 11.81% 189015.08 167777 201332 157477.67 0 201332 325097 325097 0.00
 
 

Action details: deadly_grace

Static Values
  • id:188091
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:25.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188091
  • name:Deadly Grace
  • school:arcane
  • tooltip:
  • description:Deal {$s1=63339 to 95008} Arcane damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:63338.72
  • base_dd_max:95008.08
 
Immolate 238615 24.2% 20.3 14.95sec 3527774 3416244 Direct 39.0 136664 273401 196553 43.8%  
Periodic 299.8 148514 297204 213608 43.8% 195.9%

Stats details: immolate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 20.32 38.99 299.75 299.75 1.0327 1.9677 71693294.64 71693294.64 0.00 117372.60 3416243.91
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 21.91 56.20% 136664.16 90751 215002 136661.21 117760 159788 2994873 2994873 0.00
crit 17.08 43.80% 273401.30 181507 430072 273436.73 224091 322515 4669198 4669198 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 168.5 56.22% 148514.12 50 521568 148736.78 128242 173506 25028161 25028161 0.00
crit 131.2 43.78% 297203.75 144 1060607 297617.92 249649 346804 39001062 39001062 0.00
 
 

Action details: immolate

Static Values
  • id:348
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:66000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.32
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:remains<=tick_time
Spelldata
  • id:348
  • name:Immolate
  • school:fire
  • tooltip:
  • description:Burns the enemy, causing {$s1=1} Fire damage immediately and an additional $157736o1 Fire damage over {$157736d=18 seconds}. |cFFFFFFFFPeriodic damage has a {$193541s1=15}% chance to generate 1 Soul Shard. Chance doubled on critical strikes.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.332000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.721500
  • base_td:0.00
  • dot_duration:18.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Incinerate 133749 13.6% 83.1 3.45sec 484286 401090 Direct 158.5 227298 454697 253979 11.7%  

Stats details: incinerate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 83.13 158.52 0.00 0.00 1.2074 0.0000 40259448.10 40259448.10 0.00 401090.39 401090.39
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 139.92 88.27% 227298.27 146693 347628 227387.00 215420 241797 31803159 31803159 0.00
crit 18.60 11.73% 454696.98 293423 695253 454857.53 383831 534682 8456289 8456289 0.00
 
 

Action details: incinerate

Static Values
  • id:29722
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:66000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:29722
  • name:Incinerate
  • school:fire
  • tooltip:
  • description:Draws fire toward the enemy, dealing {$s2=0} Fire damage.{$?s29722=true}|!c3[][ Replaces Shadow Bolt.]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.331000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Mark of the Hidden Satyr 8859 0.9% 20.4 14.61sec 130230 0 Direct 20.4 116475 232975 130232 11.8%  

Stats details: mark_of_the_hidden_satyr

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 20.45 20.45 0.00 0.00 0.0000 0.0000 2662760.98 2662760.98 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 18.03 88.19% 116475.17 111029 140177 116494.52 111029 126435 2100339 2100339 0.00
crit 2.41 11.81% 232975.48 222059 280355 211014.22 0 280355 562422 562422 0.00
 
 

Action details: mark_of_the_hidden_satyr

Static Values
  • id:191259
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191259
  • name:Mark of the Hidden Satyr
  • school:fire
  • tooltip:
  • description:Deals fire damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:2.500000
  • spell_power_mod.direct:2.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
pet - imp 41968 / 41968
Firebolt 41968 4.3% 110.9 2.72sec 113764 95450 Direct 110.0 102515 205001 114641 11.8%  

Stats details: firebolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 110.90 110.05 0.00 0.00 1.1919 0.0000 12616143.27 12616143.27 0.00 95450.30 95450.30
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 97.03 88.17% 102515.19 65509 124059 102542.34 100375 105125 9946992 9946992 0.00
crit 13.02 11.83% 205000.92 131017 248119 205041.52 181222 230921 2669152 2669152 0.00
 
 

Action details: firebolt

Static Values
  • id:3110
  • school:fire
  • resource:energy
  • range:40.0
  • travel_speed:16.0000
  • trigger_gcd:0.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.75
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:3110
  • name:Firebolt
  • school:fire
  • tooltip:
  • description:Deals {$s1=1} Fire damage to a target.$?a231795[ Damage increased by {$231795s1=50}% if you have Immolated the target.][] |cFF777777(Right-Click to toggle)|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
pet - service_imp 120196 / 38333
Firebolt 120196 3.9% 49.4 5.51sec 232759 207572 Direct 49.1 209511 419237 234096 11.7%  

Stats details: firebolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 49.36 49.08 0.00 0.00 1.1214 0.0000 11488261.21 11488261.21 0.00 207571.66 207571.66
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 43.32 88.28% 209511.46 131017 248119 209724.17 201807 217288 9076798 9076798 0.00
crit 5.75 11.72% 419237.22 262034 496237 418509.65 0 496237 2411464 2411464 0.00
 
 

Action details: firebolt

Static Values
  • id:3110
  • school:fire
  • resource:energy
  • range:40.0
  • travel_speed:16.0000
  • trigger_gcd:0.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.75
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:3110
  • name:Firebolt
  • school:fire
  • tooltip:
  • description:Deals {$s1=1} Fire damage to a target.$?a231795[ Damage increased by {$231795s1=50}% if you have Immolated the target.][] |cFF777777(Right-Click to toggle)|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
pet - infernal 116150 / 9836
Immolation 90398 0.8% 1.0 0.00sec 2260052 0 Periodic 47.9 42229 84512 47220 11.8% 8.2%

Stats details: immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 23.93 47.86 0.0000 1.0261 2260051.73 2260051.73 0.00 92036.64 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 42.2 88.19% 42228.98 36505 43805 42232.17 41266 43319 1782513 1782513 0.00
crit 5.7 11.81% 84512.28 73009 87611 84356.43 0 87611 477539 477539 0.00
 
 

Action details: immolation

Static Values
  • id:19483
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!ticking
Spelldata
  • id:19483
  • name:Immolation
  • school:fire
  • tooltip:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
 

Action details: immolation_tick

Static Values
  • id:20153
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all enemies near the caster.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
melee 25752 0.2% 22.8 1.08sec 28240 26160 Direct 22.8 25273 50529 28240 11.7%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.80 22.80 0.00 0.00 1.0795 0.0000 643816.33 946470.99 31.98 26159.70 26159.70
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 20.12 88.25% 25273.15 21830 26196 25274.19 24740 25966 508486 747522 31.98
crit 2.68 11.75% 50529.13 43660 52392 47472.44 0 52392 135330 198949 30.05
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
pet - doomguard 94646 / 8005
Doom Bolt 94646 0.8% 11.2 2.16sec 211676 100135 Direct 11.2 189316 379233 211690 11.8%  

Stats details: doom_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.18 11.18 0.00 0.00 2.1140 0.0000 2366186.87 2366186.87 0.00 100134.87 100134.87
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 9.86 88.22% 189315.78 183200 219840 189336.26 183200 219840 1866815 1866815 0.00
crit 1.32 11.78% 379232.88 366399 439679 286653.68 0 439679 499372 499372 0.00
 
 

Action details: doom_bolt

Static Values
  • id:85692
  • school:shadow
  • resource:energy
  • range:30.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:35.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:85692
  • name:Doom Bolt
  • school:shadow
  • tooltip:
  • description:Sends a shadowy bolt at the enemy, causing {$s1=1} Shadow damage. Deals {$s2=20}% additional damage to targets below 20% health.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
pet - lord_of_flames_infernal 116171 / 9838
Immolation 90396 0.8% 1.0 0.00sec 2259979 0 Periodic 47.9 42230 84502 47219 11.8% 8.2%

Stats details: immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 23.93 47.86 0.0000 1.0261 2259978.71 2259978.71 0.00 92033.67 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 42.2 88.20% 42229.66 36505 43805 42232.35 41312 43329 1782586 1782586 0.00
crit 5.6 11.80% 84502.07 73009 87611 84244.39 0 87611 477393 477393 0.00
 
 

Action details: immolation

Static Values
  • id:19483
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!ticking
Spelldata
  • id:19483
  • name:Immolation
  • school:fire
  • tooltip:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
 

Action details: immolation_tick

Static Values
  • id:20153
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all enemies near the caster.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
melee 25776 0.2% 22.8 1.08sec 28267 26184 Direct 22.8 25273 50531 28267 11.9%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.80 22.80 0.00 0.00 1.0795 0.0000 644423.70 947363.88 31.98 26184.38 26184.38
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 20.10 88.15% 25273.03 21830 26196 25274.04 24740 25966 507879 746630 31.98
crit 2.70 11.85% 50530.99 43660 52392 47772.97 0 52392 136545 200734 30.23
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
pet - lord_of_flames_infernal 116155 / 9836
Immolation 90393 0.8% 1.0 0.00sec 2259922 0 Periodic 47.9 42233 84447 47218 11.8% 8.2%

Stats details: immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 23.93 47.86 0.0000 1.0261 2259921.76 2259921.76 0.00 92031.35 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 42.2 88.19% 42233.36 36505 43805 42236.13 41250 43296 1782643 1782643 0.00
crit 5.7 11.81% 84446.86 73009 87611 84275.76 0 87611 477279 477279 0.00
 
 

Action details: immolation

Static Values
  • id:19483
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!ticking
Spelldata
  • id:19483
  • name:Immolation
  • school:fire
  • tooltip:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
 

Action details: immolation_tick

Static Values
  • id:20153
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all enemies near the caster.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
melee 25761 0.2% 22.8 1.08sec 28251 26169 Direct 22.8 25273 50533 28251 11.8%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.80 22.80 0.00 0.00 1.0795 0.0000 644056.92 946824.68 31.98 26169.47 26169.47
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 20.11 88.21% 25272.87 21830 26196 25273.95 24637 25966 508245 747169 31.98
crit 2.69 11.79% 50533.43 43660 52392 47614.14 0 52392 135812 199656 30.12
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
pet - lord_of_flames_infernal 116145 / 9836
Immolation 90396 0.8% 1.0 0.00sec 2259979 0 Periodic 47.9 42231 84476 47219 11.8% 8.2%

Stats details: immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 23.93 47.86 0.0000 1.0261 2259978.71 2259978.71 0.00 92033.67 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 42.2 88.19% 42231.39 36505 43805 42234.24 41266 43308 1782586 1782586 0.00
crit 5.7 11.81% 84476.18 73009 87611 84267.39 0 87611 477393 477393 0.00
 
 

Action details: immolation

Static Values
  • id:19483
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!ticking
Spelldata
  • id:19483
  • name:Immolation
  • school:fire
  • tooltip:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
 

Action details: immolation_tick

Static Values
  • id:20153
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all enemies near the caster.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
melee 25749 0.2% 22.8 1.08sec 28238 26157 Direct 22.8 25269 50586 28238 11.7%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.80 22.80 0.00 0.00 1.0795 0.0000 643760.44 946388.83 31.98 26157.43 26157.43
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 20.12 88.27% 25269.35 21830 26196 25270.52 24377 25966 508542 747605 31.98
crit 2.67 11.73% 50586.31 43660 52392 47573.77 0 52392 135219 198784 30.05
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
pet - shadowy_tear 120528 / 20915
Shadow Bolt 120528 2.1% 4.5 57.90sec 1393757 0 Periodic 50.0 111943 223717 125080 11.8% 20.3%

Stats details: shadow_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.49 0.00 50.32 50.04 0.0000 1.2140 6258839.49 6258839.49 0.00 102461.15 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 44.2 88.25% 111943.31 63 134787 111727.01 0 134787 4943075 4943075 0.00
crit 5.9 11.75% 223716.90 239 269574 218436.02 0 269574 1315765 1315765 0.00
 
 

Action details: shadow_bolt

Static Values
  • id:196657
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:196657
  • name:Shadow Bolt
  • school:shadow
  • tooltip:
  • description:Sends a shadowy bolt at the enemy, causing {$s1=1} Shadow damage.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:14.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
pet - chaos_tear 134806 / 9475
Chaos Bolt 134806 1.0% 4.4 58.02sec 638631 328103 Direct 4.4 0 642991 642991 100.0%  

Stats details: chaos_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.45 4.42 0.00 0.00 1.9466 0.0000 2840390.14 2840390.14 0.00 328103.29 328103.29
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 4.42 100.00% 642990.54 596691 753338 643811.29 0 753338 2840390 2840390 0.00
 
 

Action details: chaos_bolt

Static Values
  • id:215279
  • school:chromatic
  • resource:none
  • range:100.0
  • travel_speed:16.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:5.500
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:215279
  • name:Chaos Bolt
  • school:chromatic
  • tooltip:
  • description:Unleashes a devastating blast of chaos, causing {$s1=1} Chaos damage. Chaos Bolt always critically strikes and your critical strike chance increases its damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:5.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
pet - chaos_portal 246790 / 18869
Chaos Barrage 246790 1.9% 4.5 58.43sec 1263834 0 Periodic 159.1 31689 63404 35420 11.8% 8.0%

Stats details: chaos_barrage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.46 0.00 159.87 159.08 0.0000 0.1514 5634473.17 5634473.17 0.00 232714.07 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 140.4 88.24% 31688.95 132 37067 31601.70 0 37067 4447918 4447918 0.00
crit 18.7 11.76% 63404.15 265 74135 63211.45 0 74135 1186555 1186555 0.00
 
 

Action details: chaos_barrage

Static Values
  • id:187394
  • school:magic
  • resource:none
  • range:100.0
  • travel_speed:24.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:187394
  • name:Chaos Barrage
  • school:magic
  • tooltip:
  • description:Deals {$s1=1} Chaos damage.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:5.50
  • base_tick_time:0.25
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Simple Action Stats Execute Interval
Norgannon's
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Norgannon's
  • harmful:false
  • if_expr:
 
Berserking 2.1 180.65sec

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.07 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=15}%.
  • description:Increases your haste by {$s1=15}% for {$d=10 seconds}.
 
Dimensional Rift 13.3 22.85sec

Stats details: dimensional_rift

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.32 0.00 0.00 0.00 0.9925 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: dimensional_rift

Static Values
  • id:196586
  • school:none
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:45.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:charges=3
Spelldata
  • id:196586
  • name:Dimensional Rift
  • school:chaos
  • tooltip:
  • description:Rips a hole in time and space, opening a portal that damages your target.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Norgannon's
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Norgannon's
  • harmful:false
  • if_expr:
 
Havoc 14.9 20.90sec

Stats details: havoc

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.90 0.00 0.00 0.00 1.0497 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: havoc

Static Values
  • id:80240
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:88000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies>1&(active_enemies<4|talent.wreak_havoc.enabled&active_enemies<6)&!debuff.havoc.remains
Spelldata
  • id:80240
  • name:Havoc
  • school:shadow
  • tooltip:Spells cast by the Warlock also hit this target.
  • description:Marks a target with Havoc for {$d=8 seconds}, causing your single target spells to also strike the Havoc victim. Limit 1.
 
Life Tap 8.0 29.14sec

Stats details: life_tap

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.01 0.00 0.00 0.00 1.0266 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: life_tap

Static Values
  • id:1454
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.empowered_life_tap.enabled&!buff.empowered_life_tap.remains
Spelldata
  • id:1454
  • name:Life Tap
  • school:shadow
  • tooltip:
  • description:Restores {$s1=30}% of your maximum mana, at the cost of {$s2=10}% of your maximum health.
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Grimoire: Imp (service_imp) 3.7 91.91sec

Stats details: service_imp

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.67 0.00 0.00 0.00 0.9561 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: service_imp

Static Values
  • id:111859
  • school:shadow
  • resource:soul_shard
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:90.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:111859
  • name:Grimoire: Imp
  • school:shadow
  • tooltip:
  • description:Summons an Imp who attacks the target for {$108501s1=25} sec. Imps cast ranged Firebolts and cleanse a hostile magic effect from their master.
 
Soul Harvest 2.9 121.08sec

Stats details: soul_harvest

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.90 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: soul_harvest

Static Values
  • id:196098
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:196098
  • name:Soul Harvest
  • school:shadow
  • tooltip:Damage increased by {$s1=20}%.
  • description:Increases your damage and your pets' damage by {$s1=20}%. Lasts {$d=15 seconds}, increased by {$s2=2} sec for each target afflicted by your {$?s137043=false}[Agony][]{$?s137044=false}[Doom][]{$?s137046=false}[Immolate][], up to a maximum of {$s3=35} sec.
 
Summon Doomguard 1.0 0.00sec

Stats details: summon_doomguard

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 1.0617 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_doomguard

Static Values
  • id:18540
  • school:shadow
  • resource:soul_shard
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.grimoire_of_supremacy.enabled&active_enemies=1&artifact.lord_of_flames.rank=0
Spelldata
  • id:18540
  • name:Summon Doomguard
  • school:shadow
  • tooltip:
  • description:Summons a Doomguard for {$60478d=25 seconds} to assault the target with its Doom Bolts.
 
Summon Imp 1.0 0.00sec

Stats details: summon_imp

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_imp

Static Values
  • id:688
  • school:shadow
  • resource:soul_shard
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!talent.grimoire_of_supremacy.enabled&(!talent.grimoire_of_sacrifice.enabled|buff.demonic_power.down)
Spelldata
  • id:688
  • name:Summon Imp
  • school:shadow
  • tooltip:
  • description:Summons an Imp under your command that casts ranged Firebolts.$?s74434[ |cFFFFFFFFSoulburn:|r |cFF8282FFInstant cast.|r][]
 
Summon Infernal 1.0 0.00sec

Stats details: summon_infernal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.7545 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_infernal

Static Values
  • id:1122
  • school:shadow
  • resource:soul_shard
  • range:30.0
  • travel_speed:1.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.grimoire_of_supremacy.enabled&artifact.lord_of_flames.rank>0
Spelldata
  • id:1122
  • name:Summon Infernal
  • school:shadow
  • tooltip:
  • description:Summons an Infernal from the Twisting Nether, impacting for {$22703s1=0} Fire damage and stunning all enemy targets in the area for {$22703d=2 seconds}. The Infernal will serve you for {$111685d=25 seconds}, dealing strong area-of-effect damage.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Accelerando 20.1 0.0 15.4sec 15.4sec 78.43% 78.43% 1.4(1.4) 19.3

Buff details

  • buff initial source:Norgannon's
  • cooldown name:buff_accelerando
  • max_stacks:5
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:734.41

Stack Uptimes

  • accelerando_1:29.78%
  • accelerando_2:24.58%
  • accelerando_3:14.65%
  • accelerando_4:6.50%
  • accelerando_5:2.92%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225719
  • name:Accelerando
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc225125=Your damaging spells have a chance to grant you {$225719s1=528} Haste for {$225719d=12 seconds}, stacking up to 5 times. Stacking does not refresh duration.}
  • max_stacks:5
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Berserking 2.1 0.0 180.7sec 180.7sec 6.87% 8.40% 0.0(0.0) 2.0

Buff details

  • buff initial source:Norgannon's
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:10.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • berserking_1:6.87%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=15}%.
  • description:Increases your haste by {$s1=15}% for {$d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.55% 15.44% 0.0(0.0) 1.0

Buff details

  • buff initial source:Norgannon's
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:13.55%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Conflagration of Chaos 24.7 0.0 12.1sec 12.1sec 49.42% 47.95% 0.0(0.0) 0.6

Buff details

  • buff initial source:Norgannon's
  • cooldown name:buff_conflagration_of_chaos
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:50.00%
  • default_value:-0.00

Stack Uptimes

  • conflagration_of_chaos_1:49.42%

Trigger Attempt Success

  • trigger_pct:50.19%

Spelldata details

  • id:196546
  • name:Conflagration of Chaos
  • tooltip:Your {$?s17877=false}[Shadowburn][Conflagrate] will always critically strike. Critical strike chance will increase the critical strike damage of {$?s17877=false}[Shadowburn][Conflagrate].
  • description:{$@spelldesc219195={$?s17877=false}[Shadowburn][Conflagrate] has a chance to guarantee your next {$?s17877=false}[Shadowburn][Conflagrate] critically strikes, and to increase its damage by your critical strike chance.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Devil's Due 3.5 0.0 69.9sec 69.9sec 8.70% 10.30% 0.0(0.0) 3.2

Buff details

  • buff initial source:Norgannon's
  • cooldown name:buff_devils_due
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.18

Stack Uptimes

  • devils_due_1:8.70%

Trigger Attempt Success

  • trigger_pct:99.95%

Spelldata details

  • id:225776
  • name:Devil's Due
  • tooltip:Cast speed slowed by {$s1=7}%.
  • description:{$@spelldesc225142=Your damaging spells have a chance to grant Nefarious Pact, increasing your casting speed by {$225774s1=17}% for {$225774d=12 seconds}. When Nefarious Pact expires, your casting speed is decreased by {$225776s1=7}% for {$225776d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Embrace Chaos 26.2 32.7 11.7sec 5.0sec 59.36% 66.84% 32.7(32.7) 25.6

Buff details

  • buff initial source:Norgannon's
  • cooldown name:buff_embrace_chaos
  • max_stacks:1
  • duration:4.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • embrace_chaos_1:59.36%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:212019
  • name:Embrace Chaos
  • tooltip:Chaos Bolt has {$s1=40}% reduced cast time.
  • description:{$@spelldesc212018=Casting Chaos Bolt reduces the cast time of your next Chaos Bolt by {$212019s1=40}% for {$212019d=4 seconds}.}
  • max_stacks:0
  • duration:4.00
  • cooldown:0.00
  • default_chance:0.00%
Lord of Flames 1.0 0.0 0.0sec 0.0sec 97.90% 97.90% 0.0(0.0) 0.0

Buff details

  • buff initial source:Norgannon's
  • cooldown name:buff_lord_of_flames
  • max_stacks:1
  • duration:600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • lord_of_flames_1:97.90%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:226802
  • name:Lord of Flames
  • tooltip:Recently activated Lord of Flames.
  • description:{$@spelldesc224103=Once every {$s2=10} minutes, {$?s152107=false}[your Infernal's Meteor Strike][Summon Infernal] will summon {$s3=3} additional Infernals to serve you for {$226804d=25 seconds}.}
  • max_stacks:0
  • duration:600.00
  • cooldown:0.00
  • default_chance:0.00%
Nefarious Pact 3.5 0.0 70.2sec 69.5sec 13.54% 15.04% 0.0(0.0) 3.3

Buff details

  • buff initial source:Norgannon's
  • cooldown name:buff_nefarious_pact
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.44

Stack Uptimes

  • nefarious_pact_1:13.54%

Trigger Attempt Success

  • trigger_pct:99.95%

Spelldata details

  • id:225774
  • name:Nefarious Pact
  • tooltip:Cast speed increased by {$s1=17}%.
  • description:{$@spelldesc225142=Your damaging spells have a chance to grant Nefarious Pact, increasing your casting speed by {$225774s1=17}% for {$225774d=12 seconds}. When Nefarious Pact expires, your casting speed is decreased by {$225776s1=7}% for {$225776d=8 seconds}.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of Deadly Grace 1.0 0.0 0.0sec 0.0sec 10.16% 10.16% 0.0(0.0) 1.0

Buff details

  • buff initial source:Norgannon's
  • cooldown name:buff_potion_of_deadly_grace
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_deadly_grace_1:10.16%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188027
  • name:Potion of Deadly Grace
  • tooltip:Your attacks have a chance to unleash a bolt of energy at your target.
  • description:Grants your attacks a chance to unleash a bolt of energy at your target. Staying away from enemies for the entire duration of the effect will extend the effect by an additional 5 seconds.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
Potion of Prolonged Power 1.0 0.0 0.0sec 0.0sec 19.64% 19.64% 0.0(0.0) 1.0

Buff details

  • buff initial source:Norgannon's
  • cooldown name:buff_potion_of_prolonged_power
  • max_stacks:1
  • duration:60.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:all
  • amount:2500.00

Stack Uptimes

  • potion_of_prolonged_power_1:19.64%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:229206
  • name:Potion of Prolonged Power
  • tooltip:All stats increased by {$s1=2500}.
  • description:Drink to increase all stats by {$s1=2500} for {$d=60 seconds}.
  • max_stacks:0
  • duration:60.00
  • cooldown:1.00
  • default_chance:0.00%
Soul Harvest 2.9 0.0 121.1sec 121.1sec 17.75% 17.75% 0.0(0.0) 2.7

Buff details

  • buff initial source:Norgannon's
  • cooldown name:buff_soul_harvest
  • max_stacks:1
  • duration:15.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • soul_harvest_1:17.75%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:196098
  • name:Soul Harvest
  • tooltip:Damage increased by {$s1=20}%.
  • description:Increases your damage and your pets' damage by {$s1=20}%. Lasts {$d=15 seconds}, increased by {$s2=2} sec for each target afflicted by your {$?s137043=false}[Agony][]{$?s137044=false}[Doom][]{$?s137046=false}[Immolate][], up to a maximum of {$s3=35} sec.
  • max_stacks:0
  • duration:15.00
  • cooldown:120.00
  • default_chance:0.00%
Constant Buffs
Well Fed (azshari_salad)

Buff details

  • buff initial source:Norgannon's
  • cooldown name:buff_azshari_salad
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:375.00

Stack Uptimes

  • azshari_salad_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225603
  • name:Well Fed
  • tooltip:Haste increased by $w1.
  • description:Increases haste by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Defiled Augmentation

Buff details

  • buff initial source:Norgannon's
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Whispered Pact

Buff details

  • buff initial source:Norgannon's
  • cooldown name:buff_flask_of_the_whispered_pact
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:1300.00

Stack Uptimes

  • flask_of_the_whispered_pact_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188031
  • name:Flask of the Whispered Pact
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Norgannon's Foresight (_ready)

Buff details

  • buff initial source:Norgannon's
  • cooldown name:buff_norgannons_foresight_ready
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • norgannons_foresight_ready_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:236380
  • name:Norgannon's Foresight
  • tooltip:Your spells may be castable while moving.
  • description:{$@spelldesc236373=Standing still for {$234797d=8 seconds} grants you Foresight, allowing you to cast while moving for ${{$236380s1=5000}/1000} sec. This duration begins when you start moving.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval
shadowy_tear 4.5 58.4sec
chaos_tear 4.4 58.1sec
chaos_portal 4.4 58.4sec
dimension_ripper 4.2 52.8sec

Resources

Resource Usage Type Count Total Average RPE APR
Norgannon's
chaos_bolt Soul Shard 58.9 117.9 2.0 2.0 804145.3
havoc Mana 14.9 1310859.5 88000.0 88000.2 0.0
immolate Mana 20.3 1341265.4 66000.0 65998.9 53.5
incinerate Mana 83.1 5486788.6 66000.0 66001.3 7.3
service_imp Soul Shard 3.7 3.7 1.0 1.0 0.0
summon_doomguard Soul Shard 1.0 1.0 1.0 1.0 0.0
summon_infernal Soul Shard 1.0 1.0 1.0 1.0 0.0
pet - imp
firebolt Energy 110.9 4435.9 40.0 40.0 2844.1
pet - service_imp
firebolt Energy 49.4 1974.3 40.0 40.0 5818.9
pet - doomguard
doom_bolt Energy 11.2 391.2 35.0 35.0 6047.8
Resource Gains Type Count Total Average Overflow
life_tap Mana 8.01 2642474.26 (36.32%) 330000.00 0.00 0.00%
immolate Soul Shard 64.70 64.20 (52.55%) 0.99 0.50 0.78%
conflagrate Soul Shard 49.21 49.16 (40.24%) 1.00 0.05 0.10%
mp5_regen Mana 485.62 4633312.79 (63.68%) 9541.05 91022.99 1.93%
soulsnatcher Soul Shard 8.81 8.81 (7.21%) 1.00 0.00 0.00%
pet - imp
energy_regen Energy 1908.24 4269.52 (100.00%) 2.24 21.59 0.50%
pet - service_imp
energy_regen Energy 451.22 1373.18 (100.00%) 3.04 61.68 4.30%
pet - doomguard
energy_regen Energy 16.12 350.31 (100.00%) 21.73 43.15 10.97%
Resource RPS-Gain RPS-Loss
Health 0.00 8401.10
Mana 24162.03 27028.32
Soul Shard 0.41 0.41
Combat End Resource Mean Min Max
Mana 234676.77 1824.94 517420.18
Soul Shard 1.62 0.00 5.00

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 1.3%

Statistics & Data Analysis

Fight Length
Sample Data Norgannon's Fight Length
Count 9999
Mean 301.12
Minimum 221.26
Maximum 379.15
Spread ( max - min ) 157.89
Range [ ( max - min ) / 2 * 100% ] 26.22%
DPS
Sample Data Norgannon's Damage Per Second
Count 9999
Mean 985055.81
Minimum 871912.84
Maximum 1164172.09
Spread ( max - min ) 292259.25
Range [ ( max - min ) / 2 * 100% ] 14.83%
Priority Target DPS
Sample Data Norgannon's Priority Target Damage Per Second
Count 9999
Mean 576188.56
Minimum 513709.29
Maximum 686071.34
Spread ( max - min ) 172362.05
Range [ ( max - min ) / 2 * 100% ] 14.96%
DPS(e)
Sample Data Norgannon's Damage Per Second (Effective)
Count 9999
Mean 985055.81
Minimum 871912.84
Maximum 1164172.09
Spread ( max - min ) 292259.25
Range [ ( max - min ) / 2 * 100% ] 14.83%
Damage
Sample Data Norgannon's Damage
Count 9999
Mean 243047759.40
Minimum 165587727.63
Maximum 319516780.38
Spread ( max - min ) 153929052.75
Range [ ( max - min ) / 2 * 100% ] 31.67%
DTPS
Sample Data Norgannon's Damage Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Norgannon's Healing Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS(e)
Sample Data Norgannon's Healing Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Norgannon's Heal
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Norgannon's Healing Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Norgannon's Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
ETMI
Sample Data Norgannon'sTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data Norgannon's Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=whispered_pact
1 0.00 food,type=azshari_salad
2 0.00 summon_pet,if=!talent.grimoire_of_supremacy.enabled&(!talent.grimoire_of_sacrifice.enabled|buff.demonic_power.down)
3 0.00 summon_infernal,if=talent.grimoire_of_supremacy.enabled&artifact.lord_of_flames.rank>0
4 0.00 summon_infernal,if=talent.grimoire_of_supremacy.enabled&active_enemies>1
5 0.00 summon_doomguard,if=talent.grimoire_of_supremacy.enabled&active_enemies=1&artifact.lord_of_flames.rank=0
6 0.00 augmentation,type=defiled
7 0.00 snapshot_stats
8 0.00 grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
9 0.00 life_tap,if=talent.empowered_life_tap.enabled&!buff.empowered_life_tap.remains
A 0.00 potion,name=prolonged_power
B 0.00 chaos_bolt
Default action list Executed every time the actor is available.
# count action,conditions
C 14.90 havoc,target=2,if=active_enemies>1&(active_enemies<4|talent.wreak_havoc.enabled&active_enemies<6)&!debuff.havoc.remains
D 1.00 dimensional_rift,if=charges=3
E 10.36 immolate,if=remains<=tick_time
F 0.82 immolate,cycle_targets=1,if=active_enemies>1&remains<=tick_time&(!talent.roaring_blaze.enabled|(!debuff.roaring_blaze.remains&action.conflagrate.charges<2))
G 9.19 immolate,if=talent.roaring_blaze.enabled&remains<=duration&!debuff.roaring_blaze.remains&target.time_to_die>10&(action.conflagrate.charges=2+set_bonus.tier19_4pc|(action.conflagrate.charges>=1+set_bonus.tier19_4pc&action.conflagrate.recharge_time<cast_time+gcd)|target.time_to_die<24)
H 2.07 berserking
0.00 blood_fury
0.00 arcane_torrent
I 1.00 potion,name=deadly_grace,if=(buff.soul_harvest.remains|trinket.proc.any.react|target.time_to_die<=45)
0.00 shadowburn,if=buff.conflagration_of_chaos.remains<=action.chaos_bolt.cast_time
0.00 shadowburn,if=(charges=1&recharge_time<action.chaos_bolt.cast_time|charges=2)&soul_shard<5
J 14.00 conflagrate,if=talent.roaring_blaze.enabled&(charges=2+set_bonus.tier19_4pc|(charges>=1+set_bonus.tier19_4pc&recharge_time<gcd)|target.time_to_die<24)
K 35.21 conflagrate,if=talent.roaring_blaze.enabled&debuff.roaring_blaze.stack>0&dot.immolate.remains>dot.immolate.duration*0.3&(active_enemies=1|soul_shard<3)&soul_shard<5
0.00 conflagrate,if=!talent.roaring_blaze.enabled&!buff.backdraft.remains&buff.conflagration_of_chaos.remains<=action.chaos_bolt.cast_time
0.00 conflagrate,if=!talent.roaring_blaze.enabled&!buff.backdraft.remains&(charges=1&recharge_time<action.chaos_bolt.cast_time|charges=2)&soul_shard<5
0.00 life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<=gcd
0.00 dimensional_rift,if=equipped.144369&!buff.lessons_of_spacetime.remains&((!talent.grimoire_of_supremacy.enabled&!cooldown.summon_doomguard.remains)|(talent.grimoire_of_service.enabled&!cooldown.service_pet.remains)|(talent.soul_harvest.enabled&!cooldown.soul_harvest.remains))
L 3.67 service_pet
M 1.00 summon_infernal,if=artifact.lord_of_flames.rank>0&!buff.lord_of_flames.remains
N 1.00 summon_doomguard,if=!talent.grimoire_of_supremacy.enabled&spell_targets.infernal_awakening<=2&(target.time_to_die>180|target.health.pct<=20|target.time_to_die<30)
0.00 summon_infernal,if=!talent.grimoire_of_supremacy.enabled&spell_targets.infernal_awakening>2
0.00 summon_doomguard,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal=1&artifact.lord_of_flames.rank>0&buff.lord_of_flames.remains&!pet.doomguard.active
0.00 summon_doomguard,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal=1&equipped.132379&!cooldown.sindorei_spite_icd.remains
0.00 summon_infernal,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal>1&equipped.132379&!cooldown.sindorei_spite_icd.remains
O 2.90 soul_harvest
0.00 channel_demonfire,if=dot.immolate.remains>cast_time
0.00 havoc,if=active_enemies=1&talent.wreak_havoc.enabled&equipped.132375&!debuff.havoc.remains
0.00 rain_of_fire,if=active_enemies>=3&cooldown.havoc.remains<=12&!talent.wreak_havoc.enabled
0.00 rain_of_fire,if=active_enemies>=6&talent.wreak_havoc.enabled
P 12.32 dimensional_rift,if=!equipped.144369|charges>1|((!talent.grimoire_of_service.enabled|recharge_time<cooldown.service_pet.remains)&(!talent.soul_harvest.enabled|recharge_time<cooldown.soul_harvest.remains)&(!talent.grimoire_of_supremacy.enabled|recharge_time<cooldown.summon_doomguard.remains))
0.00 life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<duration*0.3
0.00 cataclysm
Q 58.23 chaos_bolt,if=(cooldown.havoc.remains>12&cooldown.havoc.remains|active_enemies<3|talent.wreak_havoc.enabled&active_enemies<6)
0.00 shadowburn
0.00 conflagrate,if=!talent.roaring_blaze.enabled&!buff.backdraft.remains
0.00 immolate,if=!talent.roaring_blaze.enabled&remains<=duration*0.3
R 83.48 incinerate
S 8.01 life_tap

Sample Sequence

0126ABCDEGHJKLKMOPKPQQRKPQRRRKRRRCQRRRRQERRQGJKQKQRKQRCRRQKQPRRRRRSQEQQRCGJKKQQKQRRRKRRRCRSEQRRPQQGJKLKQCKQRRPKQRRQERRRSCQOIRGJKKQQKPQQRRCKPQREQRRRRRSRGJCKQKQQKQRRKQRPRHRCEQRSLRRRGJQKQQKKQCQRRKQRRQRRQESRRQCGJKKPQNKQQRRKRQCORERRSRRRRRGJKKQCQKPQRRJRQRJLESGCJQQRRJRRR

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask Norgannon's 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 1 food Norgannon's 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 2 summon_imp Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 6 augmentation Norgannon's 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat A potion Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard potion_of_prolonged_power
0:00.000 precombat B chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard embrace_chaos, accelerando, potion_of_prolonged_power
0:00.000 default C havoc enemy2 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard embrace_chaos, accelerando, potion_of_prolonged_power
0:01.120 default D dimensional_rift Fluffy_Pillow 1033514.4/1100000: 94% mana | 1.0/5: 20% soul_shard bloodlust, embrace_chaos, accelerando, potion_of_prolonged_power
0:01.984 default E immolate Fluffy_Pillow 1050353.4/1100000: 95% mana | 1.0/5: 20% soul_shard bloodlust, embrace_chaos, accelerando(2), potion_of_prolonged_power
0:02.835 default G immolate Fluffy_Pillow 1000939.0/1100000: 91% mana | 1.0/5: 20% soul_shard bloodlust, embrace_chaos, accelerando(2), potion_of_prolonged_power
0:03.688 default H berserking Fluffy_Pillow 951563.6/1100000: 87% mana | 1.0/5: 20% soul_shard bloodlust, embrace_chaos, accelerando(2), potion_of_prolonged_power
0:03.688 default J conflagrate Fluffy_Pillow 951563.6/1100000: 87% mana | 1.0/5: 20% soul_shard bloodlust, berserking, embrace_chaos, accelerando(2), potion_of_prolonged_power
0:04.442 default K conflagrate Fluffy_Pillow 968463.0/1100000: 88% mana | 2.0/5: 40% soul_shard bloodlust, berserking, accelerando(2), potion_of_prolonged_power
0:05.196 default L service_imp Fluffy_Pillow 985362.4/1100000: 90% mana | 3.0/5: 60% soul_shard bloodlust, berserking, accelerando(2), potion_of_prolonged_power
0:05.951 default K conflagrate Fluffy_Pillow 1002284.2/1100000: 91% mana | 2.0/5: 40% soul_shard bloodlust, berserking, accelerando(2), potion_of_prolonged_power
0:06.707 default M summon_infernal Fluffy_Pillow 1019228.5/1100000: 93% mana | 3.0/5: 60% soul_shard bloodlust, berserking, conflagration_of_chaos, accelerando(2), potion_of_prolonged_power
0:07.462 default O soul_harvest Fluffy_Pillow 1036150.3/1100000: 94% mana | 2.0/5: 40% soul_shard bloodlust, berserking, lord_of_flames, conflagration_of_chaos, accelerando(2), potion_of_prolonged_power
0:07.462 default P dimensional_rift Fluffy_Pillow 1036150.3/1100000: 94% mana | 2.0/5: 40% soul_shard bloodlust, berserking, soul_harvest, lord_of_flames, conflagration_of_chaos, accelerando(2), potion_of_prolonged_power
0:08.216 default K conflagrate Fluffy_Pillow 1053049.7/1100000: 96% mana | 2.0/5: 40% soul_shard bloodlust, berserking, soul_harvest, lord_of_flames, conflagration_of_chaos, accelerando(2), potion_of_prolonged_power
0:08.970 default P dimensional_rift Fluffy_Pillow 1069949.1/1100000: 97% mana | 4.0/5: 80% soul_shard bloodlust, berserking, soul_harvest, lord_of_flames, conflagration_of_chaos, accelerando(2), potion_of_prolonged_power
0:09.724 default Q chaos_bolt Fluffy_Pillow 1086848.5/1100000: 99% mana | 4.0/5: 80% soul_shard bloodlust, berserking, soul_harvest, lord_of_flames, conflagration_of_chaos, accelerando(2), potion_of_prolonged_power
0:11.202 default Q chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 2.0/5: 40% soul_shard bloodlust, berserking, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2), potion_of_prolonged_power
0:12.089 default R incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/5: 0% soul_shard bloodlust, berserking, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, potion_of_prolonged_power
0:13.002 default K conflagrate Fluffy_Pillow 1034087.1/1100000: 94% mana | 0.0/5: 0% soul_shard bloodlust, berserking, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, potion_of_prolonged_power
0:13.765 default P dimensional_rift Fluffy_Pillow 1050478.0/1100000: 95% mana | 2.0/5: 40% soul_shard bloodlust, soul_harvest, lord_of_flames, embrace_chaos, nefarious_pact, potion_of_prolonged_power
0:14.521 default Q chaos_bolt Fluffy_Pillow 1064788.6/1100000: 97% mana | 2.0/5: 40% soul_shard bloodlust, soul_harvest, lord_of_flames, embrace_chaos, nefarious_pact, potion_of_prolonged_power
0:15.276 default R incinerate Fluffy_Pillow 1079080.3/1100000: 98% mana | 0.0/5: 0% soul_shard bloodlust, soul_harvest, lord_of_flames, embrace_chaos, nefarious_pact, potion_of_prolonged_power
0:16.030 default R incinerate Fluffy_Pillow 1027353.1/1100000: 93% mana | 0.0/5: 0% soul_shard bloodlust, soul_harvest, lord_of_flames, embrace_chaos, nefarious_pact, potion_of_prolonged_power
0:16.784 default R incinerate Fluffy_Pillow 975625.8/1100000: 89% mana | 0.0/5: 0% soul_shard bloodlust, soul_harvest, lord_of_flames, embrace_chaos, nefarious_pact, potion_of_prolonged_power
0:17.539 default K conflagrate Fluffy_Pillow 923917.5/1100000: 84% mana | 0.0/5: 0% soul_shard bloodlust, soul_harvest, lord_of_flames, embrace_chaos, nefarious_pact, potion_of_prolonged_power
0:18.344 default R incinerate Fluffy_Pillow 939155.7/1100000: 85% mana | 1.0/5: 20% soul_shard bloodlust, soul_harvest, lord_of_flames, embrace_chaos, nefarious_pact, potion_of_prolonged_power
0:19.098 default R incinerate Fluffy_Pillow 887428.5/1100000: 81% mana | 1.0/5: 20% soul_shard bloodlust, soul_harvest, lord_of_flames, embrace_chaos, nefarious_pact, potion_of_prolonged_power
0:19.851 default R incinerate Fluffy_Pillow 835682.3/1100000: 76% mana | 1.0/5: 20% soul_shard bloodlust, soul_harvest, lord_of_flames, nefarious_pact, potion_of_prolonged_power
0:20.608 default C havoc enemy2 784011.8/1100000: 71% mana | 2.0/5: 40% soul_shard bloodlust, soul_harvest, lord_of_flames, nefarious_pact, potion_of_prolonged_power
0:21.364 default Q chaos_bolt Fluffy_Pillow 710322.4/1100000: 65% mana | 2.0/5: 40% soul_shard bloodlust, soul_harvest, lord_of_flames, nefarious_pact, potion_of_prolonged_power
0:22.573 default R incinerate Fluffy_Pillow 733467.3/1100000: 67% mana | 0.0/5: 0% soul_shard bloodlust, soul_harvest, lord_of_flames, embrace_chaos, nefarious_pact, accelerando, potion_of_prolonged_power
0:23.328 default R incinerate Fluffy_Pillow 681970.3/1100000: 62% mana | 0.0/5: 0% soul_shard bloodlust, soul_harvest, lord_of_flames, embrace_chaos, nefarious_pact, accelerando, potion_of_prolonged_power
0:24.083 default R incinerate Fluffy_Pillow 630473.3/1100000: 57% mana | 0.0/5: 0% soul_shard bloodlust, soul_harvest, lord_of_flames, embrace_chaos, nefarious_pact, accelerando, potion_of_prolonged_power
0:24.836 default R incinerate Fluffy_Pillow 579040.2/1100000: 53% mana | 1.0/5: 20% soul_shard bloodlust, soul_harvest, lord_of_flames, embrace_chaos, nefarious_pact, accelerando(2), potion_of_prolonged_power
0:25.590 default Q chaos_bolt Fluffy_Pillow 527735.3/1100000: 48% mana | 2.0/5: 40% soul_shard bloodlust, soul_harvest, lord_of_flames, embrace_chaos, devils_due, accelerando(2), potion_of_prolonged_power
0:26.793 default E immolate Fluffy_Pillow 551181.2/1100000: 50% mana | 0.0/5: 0% soul_shard bloodlust, lord_of_flames, embrace_chaos, devils_due, accelerando(2), potion_of_prolonged_power
0:27.796 default R incinerate Fluffy_Pillow 504729.3/1100000: 46% mana | 1.0/5: 20% soul_shard bloodlust, lord_of_flames, embrace_chaos, devils_due, accelerando(2), potion_of_prolonged_power
0:28.998 default R incinerate Fluffy_Pillow 462157.1/1100000: 42% mana | 1.0/5: 20% soul_shard bloodlust, lord_of_flames, embrace_chaos, devils_due, accelerando(3), potion_of_prolonged_power
0:30.183 default Q chaos_bolt Fluffy_Pillow 419585.4/1100000: 38% mana | 3.0/5: 60% soul_shard bloodlust, lord_of_flames, embrace_chaos, devils_due, accelerando(4), potion_of_prolonged_power
0:31.349 default G immolate Fluffy_Pillow 442963.4/1100000: 40% mana | 1.0/5: 20% soul_shard bloodlust, lord_of_flames, embrace_chaos, devils_due, accelerando(4), potion_of_prolonged_power
0:32.324 default J conflagrate Fluffy_Pillow 396511.9/1100000: 36% mana | 1.0/5: 20% soul_shard bloodlust, lord_of_flames, embrace_chaos, devils_due, accelerando(4), potion_of_prolonged_power
0:33.298 default K conflagrate Fluffy_Pillow 416040.3/1100000: 38% mana | 2.0/5: 40% soul_shard bloodlust, lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due, accelerando(4), potion_of_prolonged_power
0:34.273 default Q chaos_bolt Fluffy_Pillow 434887.5/1100000: 40% mana | 3.0/5: 60% soul_shard bloodlust, lord_of_flames, conflagration_of_chaos, embrace_chaos, potion_of_prolonged_power
0:35.323 default K conflagrate Fluffy_Pillow 454764.7/1100000: 41% mana | 2.0/5: 40% soul_shard bloodlust, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando, potion_of_prolonged_power
0:36.186 default Q chaos_bolt Fluffy_Pillow 471342.3/1100000: 43% mana | 3.0/5: 60% soul_shard bloodlust, lord_of_flames, embrace_chaos, accelerando, potion_of_prolonged_power
0:37.221 default R incinerate Fluffy_Pillow 491223.9/1100000: 45% mana | 1.0/5: 20% soul_shard bloodlust, lord_of_flames, embrace_chaos, accelerando, potion_of_prolonged_power
0:38.255 default K conflagrate Fluffy_Pillow 445086.3/1100000: 40% mana | 1.0/5: 20% soul_shard bloodlust, lord_of_flames, embrace_chaos, accelerando, potion_of_prolonged_power
0:39.118 default Q chaos_bolt Fluffy_Pillow 461664.0/1100000: 42% mana | 2.0/5: 40% soul_shard bloodlust, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando, potion_of_prolonged_power
0:39.871 default R incinerate Fluffy_Pillow 476128.6/1100000: 43% mana | 0.0/5: 0% soul_shard bloodlust, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando, potion_of_prolonged_power
0:40.625 default C havoc enemy2 424612.4/1100000: 39% mana | 1.0/5: 20% soul_shard bloodlust, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando, potion_of_prolonged_power
0:41.379 default R incinerate Fluffy_Pillow 347753.7/1100000: 32% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando, potion_of_prolonged_power
0:42.313 default R incinerate Fluffy_Pillow 295554.9/1100000: 27% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando, potion_of_prolonged_power
0:43.245 default Q chaos_bolt Fluffy_Pillow 243326.5/1100000: 22% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando, potion_of_prolonged_power
0:44.177 default K conflagrate Fluffy_Pillow 257098.0/1100000: 23% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando, potion_of_prolonged_power
0:44.956 default Q chaos_bolt Fluffy_Pillow 268608.8/1100000: 24% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando, potion_of_prolonged_power
0:45.888 default P dimensional_rift Fluffy_Pillow 282381.3/1100000: 26% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(2), potion_of_prolonged_power
0:46.886 default R incinerate Fluffy_Pillow 297343.3/1100000: 27% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(2), potion_of_prolonged_power
0:47.806 default R incinerate Fluffy_Pillow 244925.6/1100000: 22% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, potion_of_prolonged_power
0:48.753 default R incinerate Fluffy_Pillow 192714.9/1100000: 18% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, potion_of_prolonged_power
0:49.699 default R incinerate Fluffy_Pillow 140489.7/1100000: 13% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, potion_of_prolonged_power
0:50.646 default R incinerate Fluffy_Pillow 88279.0/1100000: 8% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, nefarious_pact, potion_of_prolonged_power
0:51.592 default S life_tap Fluffy_Pillow 36053.8/1100000: 3% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, devils_due, potion_of_prolonged_power
0:52.934 default Q chaos_bolt Fluffy_Pillow 385594.7/1100000: 35% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, devils_due, potion_of_prolonged_power
0:55.608 default E immolate Fluffy_Pillow 424931.1/1100000: 39% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due, accelerando, potion_of_prolonged_power
0:56.927 default Q chaos_bolt Fluffy_Pillow 378421.1/1100000: 34% mana | 4.0/5: 80% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due, accelerando, potion_of_prolonged_power
0:58.510 default Q chaos_bolt Fluffy_Pillow 401812.1/1100000: 37% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due, accelerando
1:00.092 default R incinerate Fluffy_Pillow 425188.3/1100000: 39% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
1:01.434 default C havoc enemy2 379018.9/1100000: 34% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
1:02.537 default G immolate Fluffy_Pillow 307555.0/1100000: 28% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
1:03.641 default J conflagrate Fluffy_Pillow 258106.2/1100000: 23% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
1:04.747 default K conflagrate Fluffy_Pillow 274687.3/1100000: 25% mana | 1.0/5: 20% soul_shard lord_of_flames, accelerando(2)
1:05.851 default K conflagrate Fluffy_Pillow 291194.9/1100000: 26% mana | 2.0/5: 40% soul_shard lord_of_flames
1:06.988 default Q chaos_bolt Fluffy_Pillow 307995.6/1100000: 28% mana | 3.0/5: 60% soul_shard lord_of_flames, accelerando
1:09.227 default Q chaos_bolt Fluffy_Pillow 341253.5/1100000: 31% mana | 3.0/5: 60% soul_shard lord_of_flames, embrace_chaos, accelerando(2)
1:10.551 default K conflagrate Fluffy_Pillow 361103.7/1100000: 33% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando(3)
1:11.759 default Q chaos_bolt Fluffy_Pillow 379474.1/1100000: 34% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando(3)
1:13.066 default R incinerate Fluffy_Pillow 399408.9/1100000: 36% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos, accelerando(4)
1:14.354 default R incinerate Fluffy_Pillow 353273.6/1100000: 32% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos, accelerando(4)
1:15.643 default R incinerate Fluffy_Pillow 307153.7/1100000: 28% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos, accelerando(4)
1:16.931 default K conflagrate Fluffy_Pillow 261019.4/1100000: 24% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos, accelerando(5)
1:18.175 default R incinerate Fluffy_Pillow 280124.3/1100000: 25% mana | 1.0/5: 20% soul_shard lord_of_flames
1:19.537 default R incinerate Fluffy_Pillow 234026.5/1100000: 21% mana | 1.0/5: 20% soul_shard lord_of_flames, accelerando
1:20.881 default R incinerate Fluffy_Pillow 187887.0/1100000: 17% mana | 1.0/5: 20% soul_shard lord_of_flames, accelerando(2)
1:22.205 default C havoc enemy2 141736.4/1100000: 13% mana | 1.0/5: 20% soul_shard lord_of_flames, accelerando(2)
1:23.309 default R incinerate Fluffy_Pillow 70287.5/1100000: 6% mana | 1.0/5: 20% soul_shard lord_of_flames, accelerando(2)
1:24.633 default S life_tap Fluffy_Pillow 24349.2/1100000: 2% mana | 1.0/5: 20% soul_shard lord_of_flames, accelerando(3)
1:25.723 default E immolate Fluffy_Pillow 370925.1/1100000: 34% mana | 1.0/5: 20% soul_shard lord_of_flames, accelerando(3)
1:26.810 default Q chaos_bolt Fluffy_Pillow 321662.8/1100000: 29% mana | 2.0/5: 40% soul_shard lord_of_flames, accelerando(4)
1:28.952 default R incinerate Fluffy_Pillow 354699.3/1100000: 32% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando(5)
1:30.224 default R incinerate Fluffy_Pillow 308591.0/1100000: 28% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando(5)
1:31.496 default P dimensional_rift Fluffy_Pillow 262176.9/1100000: 24% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos
1:32.636 default Q chaos_bolt Fluffy_Pillow 278776.5/1100000: 25% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos
1:33.999 default Q chaos_bolt Fluffy_Pillow 298624.1/1100000: 27% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando
1:35.343 default G immolate Fluffy_Pillow 318483.6/1100000: 29% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos, accelerando
1:36.462 default J conflagrate Fluffy_Pillow 269018.3/1100000: 24% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando
1:37.584 default K conflagrate Fluffy_Pillow 285597.4/1100000: 26% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
1:38.705 default L service_imp Fluffy_Pillow 302161.7/1100000: 27% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
1:39.825 default K conflagrate Fluffy_Pillow 318711.3/1100000: 29% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, accelerando
1:40.946 default Q chaos_bolt Fluffy_Pillow 335517.3/1100000: 31% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, accelerando(2)
1:43.153 default C havoc enemy2 368604.6/1100000: 34% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
1:44.257 default K conflagrate Fluffy_Pillow 297155.7/1100000: 27% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
1:45.363 default Q chaos_bolt Fluffy_Pillow 313736.8/1100000: 29% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
1:46.687 default R incinerate Fluffy_Pillow 333288.0/1100000: 30% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
1:48.052 default R incinerate Fluffy_Pillow 287163.9/1100000: 26% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
1:49.416 default P dimensional_rift Fluffy_Pillow 241025.2/1100000: 22% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
1:50.553 default K conflagrate Fluffy_Pillow 257581.1/1100000: 23% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
1:51.689 default Q chaos_bolt Fluffy_Pillow 274367.1/1100000: 25% mana | 2.0/5: 40% soul_shard lord_of_flames, accelerando
1:53.927 default R incinerate Fluffy_Pillow 307495.9/1100000: 28% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando(2)
1:55.251 default R incinerate Fluffy_Pillow 261345.2/1100000: 24% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando(2)
1:56.574 default Q chaos_bolt Fluffy_Pillow 215179.6/1100000: 20% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando(2)
1:57.900 default E immolate Fluffy_Pillow 235059.0/1100000: 21% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos, accelerando(2)
1:59.005 default R incinerate Fluffy_Pillow 185625.1/1100000: 17% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos, accelerando(2)
2:00.331 default R incinerate Fluffy_Pillow 139504.5/1100000: 13% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando(2)
2:01.655 default R incinerate Fluffy_Pillow 93353.8/1100000: 8% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando(2)
2:02.981 default S life_tap Fluffy_Pillow 47050.1/1100000: 4% mana | 1.0/5: 20% soul_shard lord_of_flames, accelerando
2:04.102 default C havoc enemy2 393614.4/1100000: 36% mana | 1.0/5: 20% soul_shard lord_of_flames, accelerando
2:05.222 default Q chaos_bolt Fluffy_Pillow 322163.9/1100000: 29% mana | 2.0/5: 40% soul_shard lord_of_flames, accelerando
2:07.458 default O soul_harvest Fluffy_Pillow 355204.5/1100000: 32% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos, accelerando(2)
2:07.462 default I potion Fluffy_Pillow 355264.5/1100000: 32% mana | 0.0/5: 0% soul_shard soul_harvest, lord_of_flames, embrace_chaos, accelerando(2)
2:07.462 default R incinerate Fluffy_Pillow 355264.5/1100000: 32% mana | 0.0/5: 0% soul_shard soul_harvest, lord_of_flames, embrace_chaos, accelerando(2), potion_of_deadly_grace
2:08.786 default G immolate Fluffy_Pillow 309113.9/1100000: 28% mana | 0.0/5: 0% soul_shard soul_harvest, lord_of_flames, embrace_chaos, accelerando(2), potion_of_deadly_grace
2:09.891 default J conflagrate Fluffy_Pillow 259680.0/1100000: 24% mana | 0.0/5: 0% soul_shard soul_harvest, lord_of_flames, embrace_chaos, accelerando(2), potion_of_deadly_grace
2:10.996 default K conflagrate Fluffy_Pillow 276260.8/1100000: 25% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3), potion_of_deadly_grace
2:12.085 default K conflagrate Fluffy_Pillow 292821.5/1100000: 27% mana | 2.0/5: 40% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, accelerando(3), potion_of_deadly_grace
2:13.173 default Q chaos_bolt Fluffy_Pillow 309367.0/1100000: 28% mana | 4.0/5: 80% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, accelerando(3), potion_of_deadly_grace
2:15.349 default Q chaos_bolt Fluffy_Pillow 342233.8/1100000: 31% mana | 3.0/5: 60% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando, potion_of_deadly_grace
2:16.692 default K conflagrate Fluffy_Pillow 362079.4/1100000: 33% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2), potion_of_deadly_grace
2:17.798 default P dimensional_rift Fluffy_Pillow 378660.5/1100000: 34% mana | 3.0/5: 60% soul_shard soul_harvest, lord_of_flames, embrace_chaos, accelerando(2), potion_of_deadly_grace
2:18.901 default Q chaos_bolt Fluffy_Pillow 395196.6/1100000: 36% mana | 3.0/5: 60% soul_shard soul_harvest, lord_of_flames, embrace_chaos, accelerando(2), potion_of_deadly_grace
2:20.226 default Q chaos_bolt Fluffy_Pillow 415061.0/1100000: 38% mana | 2.0/5: 40% soul_shard soul_harvest, lord_of_flames, embrace_chaos, accelerando(2), potion_of_deadly_grace
2:21.549 default R incinerate Fluffy_Pillow 434895.4/1100000: 40% mana | 0.0/5: 0% soul_shard soul_harvest, lord_of_flames, embrace_chaos, accelerando(2), potion_of_deadly_grace
2:22.873 default R incinerate Fluffy_Pillow 388744.7/1100000: 35% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, embrace_chaos, accelerando(2), potion_of_deadly_grace
2:24.198 default C havoc enemy2 342622.7/1100000: 31% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, embrace_chaos, accelerando(3), potion_of_deadly_grace
2:25.288 default K conflagrate Fluffy_Pillow 271198.6/1100000: 25% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, embrace_chaos, accelerando(3), potion_of_deadly_grace
2:26.378 default P dimensional_rift Fluffy_Pillow 287789.8/1100000: 26% mana | 2.0/5: 40% soul_shard soul_harvest, lord_of_flames, accelerando(4), potion_of_deadly_grace
2:27.451 default Q chaos_bolt Fluffy_Pillow 304180.9/1100000: 28% mana | 2.0/5: 40% soul_shard lord_of_flames, potion_of_deadly_grace
2:29.721 default R incinerate Fluffy_Pillow 337235.4/1100000: 31% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando, potion_of_deadly_grace
2:31.065 default E immolate Fluffy_Pillow 291094.8/1100000: 26% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando, potion_of_deadly_grace
2:32.187 default Q chaos_bolt Fluffy_Pillow 241675.2/1100000: 22% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando(2), potion_of_deadly_grace
2:33.511 default R incinerate Fluffy_Pillow 261524.6/1100000: 24% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando(2), potion_of_deadly_grace
2:34.837 default R incinerate Fluffy_Pillow 215405.2/1100000: 20% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando(3), potion_of_deadly_grace
2:36.141 default R incinerate Fluffy_Pillow 169235.5/1100000: 15% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando(3), potion_of_deadly_grace
2:37.448 default R incinerate Fluffy_Pillow 123133.6/1100000: 11% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando(4), potion_of_deadly_grace
2:38.736 default R incinerate Fluffy_Pillow 76999.4/1100000: 7% mana | 1.0/5: 20% soul_shard lord_of_flames, accelerando(5)
2:40.007 default S life_tap Fluffy_Pillow 30875.5/1100000: 3% mana | 1.0/5: 20% soul_shard lord_of_flames, accelerando(5)
2:41.068 default R incinerate Fluffy_Pillow 377467.6/1100000: 34% mana | 1.0/5: 20% soul_shard lord_of_flames, accelerando(5)
2:42.338 default G immolate Fluffy_Pillow 330659.2/1100000: 30% mana | 1.0/5: 20% soul_shard lord_of_flames
2:43.473 default J conflagrate Fluffy_Pillow 281186.0/1100000: 26% mana | 1.0/5: 20% soul_shard lord_of_flames
2:44.611 default C havoc enemy2 297756.5/1100000: 27% mana | 2.0/5: 40% soul_shard lord_of_flames
2:45.747 default K conflagrate Fluffy_Pillow 226542.5/1100000: 21% mana | 2.0/5: 40% soul_shard lord_of_flames, accelerando
2:46.867 default Q chaos_bolt Fluffy_Pillow 243092.0/1100000: 22% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, accelerando
2:49.104 default K conflagrate Fluffy_Pillow 276146.8/1100000: 25% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
2:50.225 default Q chaos_bolt Fluffy_Pillow 292711.1/1100000: 27% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
2:51.568 default Q chaos_bolt Fluffy_Pillow 312799.4/1100000: 28% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
2:52.890 default K conflagrate Fluffy_Pillow 332618.8/1100000: 30% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
2:53.997 default Q chaos_bolt Fluffy_Pillow 349214.9/1100000: 32% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando(2)
2:55.324 default R incinerate Fluffy_Pillow 369109.3/1100000: 34% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando(2)
2:56.649 default R incinerate Fluffy_Pillow 322958.3/1100000: 29% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando
2:57.992 default K conflagrate Fluffy_Pillow 276803.8/1100000: 25% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando(2)
2:59.097 default Q chaos_bolt Fluffy_Pillow 293370.0/1100000: 27% mana | 3.0/5: 60% soul_shard lord_of_flames, embrace_chaos, accelerando(2)
3:00.422 default R incinerate Fluffy_Pillow 313234.3/1100000: 28% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando(2)
3:01.746 default P dimensional_rift Fluffy_Pillow 267083.7/1100000: 24% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando(2)
3:02.850 default R incinerate Fluffy_Pillow 283634.9/1100000: 26% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando(2)
3:04.174 default H berserking Fluffy_Pillow 237484.2/1100000: 22% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando(2)
3:04.174 default R incinerate Fluffy_Pillow 237484.2/1100000: 22% mana | 1.0/5: 20% soul_shard berserking, lord_of_flames, embrace_chaos, accelerando(2)
3:05.326 default C havoc enemy2 191345.6/1100000: 17% mana | 1.0/5: 20% soul_shard berserking, lord_of_flames, accelerando(2)
3:06.285 default E immolate Fluffy_Pillow 119879.5/1100000: 11% mana | 1.0/5: 20% soul_shard berserking, lord_of_flames, accelerando(2)
3:07.245 default Q chaos_bolt Fluffy_Pillow 70430.6/1100000: 6% mana | 2.0/5: 40% soul_shard berserking, lord_of_flames, accelerando(2)
3:09.163 default R incinerate Fluffy_Pillow 103243.0/1100000: 9% mana | 0.0/5: 0% soul_shard berserking, lord_of_flames, embrace_chaos, accelerando
3:10.332 default S life_tap Fluffy_Pillow 57108.6/1100000: 5% mana | 0.0/5: 0% soul_shard berserking, lord_of_flames, embrace_chaos, accelerando(2)
3:11.293 default L service_imp Fluffy_Pillow 403677.0/1100000: 37% mana | 1.0/5: 20% soul_shard berserking, lord_of_flames, embrace_chaos, accelerando(2)
3:12.255 default R incinerate Fluffy_Pillow 420262.6/1100000: 38% mana | 0.0/5: 0% soul_shard berserking, lord_of_flames, embrace_chaos, accelerando(2)
3:13.407 default R incinerate Fluffy_Pillow 374222.0/1100000: 34% mana | 0.0/5: 0% soul_shard berserking, lord_of_flames, accelerando(3)
3:14.543 default R incinerate Fluffy_Pillow 327247.9/1100000: 30% mana | 0.0/5: 0% soul_shard lord_of_flames, accelerando(4)
3:15.831 default G immolate Fluffy_Pillow 281112.6/1100000: 26% mana | 2.0/5: 40% soul_shard lord_of_flames, accelerando(4)
3:16.903 default J conflagrate Fluffy_Pillow 231645.9/1100000: 21% mana | 2.0/5: 40% soul_shard lord_of_flames, accelerando(4)
3:17.977 default Q chaos_bolt Fluffy_Pillow 248210.1/1100000: 23% mana | 4.0/5: 80% soul_shard lord_of_flames, conflagration_of_chaos, accelerando(4)
3:20.119 default K conflagrate Fluffy_Pillow 281443.1/1100000: 26% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(5)
3:21.178 default Q chaos_bolt Fluffy_Pillow 297980.3/1100000: 27% mana | 3.0/5: 60% soul_shard lord_of_flames, embrace_chaos
3:22.542 default Q chaos_bolt Fluffy_Pillow 318106.0/1100000: 29% mana | 3.0/5: 60% soul_shard lord_of_flames, embrace_chaos, nefarious_pact, accelerando
3:23.474 default K conflagrate Fluffy_Pillow 331878.4/1100000: 30% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, nefarious_pact, accelerando(2)
3:24.241 default K conflagrate Fluffy_Pillow 343377.2/1100000: 31% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, nefarious_pact, accelerando(2)
3:25.006 default Q chaos_bolt Fluffy_Pillow 355010.8/1100000: 32% mana | 4.0/5: 80% soul_shard lord_of_flames, embrace_chaos, nefarious_pact, accelerando(3)
3:25.911 default C havoc enemy2 368773.4/1100000: 34% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, nefarious_pact, accelerando(3)
3:26.667 default Q chaos_bolt Fluffy_Pillow 292282.8/1100000: 27% mana | 3.0/5: 60% soul_shard lord_of_flames, embrace_chaos, nefarious_pact, accelerando(4)
3:27.560 default R incinerate Fluffy_Pillow 306055.5/1100000: 28% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, nefarious_pact, accelerando(4)
3:28.454 default R incinerate Fluffy_Pillow 253843.5/1100000: 23% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, nefarious_pact, accelerando(4)
3:29.348 default K conflagrate Fluffy_Pillow 201631.6/1100000: 18% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, nefarious_pact, accelerando(4)
3:30.288 default Q chaos_bolt Fluffy_Pillow 216129.1/1100000: 20% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, nefarious_pact, accelerando(4)
3:31.182 default R incinerate Fluffy_Pillow 229917.1/1100000: 21% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, nefarious_pact, accelerando(4)
3:32.074 default R incinerate Fluffy_Pillow 177674.3/1100000: 16% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, nefarious_pact, accelerando(4)
3:32.966 default Q chaos_bolt Fluffy_Pillow 125431.6/1100000: 11% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, nefarious_pact, accelerando(4)
3:33.860 default R incinerate Fluffy_Pillow 138749.1/1100000: 13% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos, devils_due
3:35.467 default R incinerate Fluffy_Pillow 96149.8/1100000: 9% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, devils_due, accelerando
3:37.051 default Q chaos_bolt Fluffy_Pillow 53555.5/1100000: 5% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, devils_due, accelerando
3:38.635 default E immolate Fluffy_Pillow 76961.3/1100000: 7% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos, devils_due, accelerando
3:39.953 default S life_tap Fluffy_Pillow 30436.6/1100000: 3% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, devils_due, accelerando
3:41.273 default R incinerate Fluffy_Pillow 379941.4/1100000: 35% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, devils_due, accelerando
3:42.856 default R incinerate Fluffy_Pillow 337332.4/1100000: 31% mana | 1.0/5: 20% soul_shard lord_of_flames, accelerando
3:44.199 default Q chaos_bolt Fluffy_Pillow 291177.1/1100000: 26% mana | 2.0/5: 40% soul_shard lord_of_flames, accelerando
3:46.439 default C havoc enemy2 324277.6/1100000: 29% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos, accelerando(2)
3:47.543 default G immolate Fluffy_Pillow 252793.9/1100000: 23% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos
3:48.681 default J conflagrate Fluffy_Pillow 203364.4/1100000: 18% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos
3:49.819 default K conflagrate Fluffy_Pillow 219934.9/1100000: 20% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos
3:50.956 default K conflagrate Fluffy_Pillow 236490.8/1100000: 21% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos
3:52.092 default P dimensional_rift Fluffy_Pillow 253032.2/1100000: 23% mana | 4.0/5: 80% soul_shard lord_of_flames, conflagration_of_chaos
3:53.231 default Q chaos_bolt Fluffy_Pillow 269617.2/1100000: 25% mana | 4.0/5: 80% soul_shard lord_of_flames, conflagration_of_chaos
3:55.503 default N summon_doomguard Fluffy_Pillow 302995.6/1100000: 28% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
3:56.623 default K conflagrate Fluffy_Pillow 319545.1/1100000: 29% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
3:57.742 default Q chaos_bolt Fluffy_Pillow 336079.9/1100000: 31% mana | 3.0/5: 60% soul_shard lord_of_flames, embrace_chaos, accelerando
3:59.087 default Q chaos_bolt Fluffy_Pillow 355954.1/1100000: 32% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando
4:00.430 default R incinerate Fluffy_Pillow 375799.6/1100000: 34% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos, accelerando(2)
4:01.754 default R incinerate Fluffy_Pillow 329649.9/1100000: 30% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos, accelerando(3)
4:03.061 default K conflagrate Fluffy_Pillow 283525.8/1100000: 26% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos, accelerando(3)
4:04.151 default R incinerate Fluffy_Pillow 300101.7/1100000: 27% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
4:05.456 default Q chaos_bolt Fluffy_Pillow 254002.4/1100000: 23% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, accelerando(4)
4:07.601 default C havoc enemy2 285866.5/1100000: 26% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
4:08.722 default O soul_harvest Fluffy_Pillow 214430.8/1100000: 19% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
4:08.722 default R incinerate Fluffy_Pillow 214430.8/1100000: 19% mana | 0.0/5: 0% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
4:10.066 default E immolate Fluffy_Pillow 168389.7/1100000: 15% mana | 0.0/5: 0% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
4:11.170 default R incinerate Fluffy_Pillow 118940.8/1100000: 11% mana | 0.0/5: 0% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
4:12.495 default R incinerate Fluffy_Pillow 72946.8/1100000: 7% mana | 0.0/5: 0% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, accelerando(3)
4:13.802 default S life_tap Fluffy_Pillow 26822.7/1100000: 2% mana | 0.0/5: 0% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, accelerando(3)
4:14.890 default R incinerate Fluffy_Pillow 373368.3/1100000: 34% mana | 0.0/5: 0% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, accelerando(3)
4:16.197 default R incinerate Fluffy_Pillow 327248.3/1100000: 30% mana | 0.0/5: 0% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, accelerando(4)
4:17.484 default R incinerate Fluffy_Pillow 281097.5/1100000: 26% mana | 0.0/5: 0% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, accelerando(4)
4:18.774 default R incinerate Fluffy_Pillow 234993.0/1100000: 21% mana | 0.0/5: 0% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, accelerando(4)
4:20.060 default R incinerate Fluffy_Pillow 188232.9/1100000: 17% mana | 0.0/5: 0% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, accelerando
4:21.402 default G immolate Fluffy_Pillow 142063.4/1100000: 13% mana | 0.0/5: 0% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, accelerando(2)
4:22.507 default J conflagrate Fluffy_Pillow 92630.6/1100000: 8% mana | 0.0/5: 0% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, accelerando(3)
4:23.597 default K conflagrate Fluffy_Pillow 109206.5/1100000: 10% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, accelerando(3)
4:24.688 default K conflagrate Fluffy_Pillow 125797.7/1100000: 11% mana | 2.0/5: 40% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, accelerando(3)
4:25.776 default Q chaos_bolt Fluffy_Pillow 142343.2/1100000: 13% mana | 3.0/5: 60% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, accelerando(3)
4:27.951 default C havoc enemy2 175420.1/1100000: 16% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(4)
4:29.025 default Q chaos_bolt Fluffy_Pillow 103984.3/1100000: 9% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(4)
4:30.314 default K conflagrate Fluffy_Pillow 123864.4/1100000: 11% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(4)
4:31.389 default P dimensional_rift Fluffy_Pillow 140448.5/1100000: 13% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(5)
4:32.448 default Q chaos_bolt Fluffy_Pillow 156588.2/1100000: 14% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
4:33.814 default R incinerate Fluffy_Pillow 176478.6/1100000: 16% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
4:35.176 default R incinerate Fluffy_Pillow 130310.8/1100000: 12% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
4:36.541 default J conflagrate Fluffy_Pillow 84186.6/1100000: 8% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
4:37.678 default R incinerate Fluffy_Pillow 100742.6/1100000: 9% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos
4:39.042 default Q chaos_bolt Fluffy_Pillow 54825.8/1100000: 5% mana | 2.0/5: 40% soul_shard lord_of_flames, accelerando
4:41.280 default R incinerate Fluffy_Pillow 88112.7/1100000: 8% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos, accelerando(2)
4:42.604 default J conflagrate Fluffy_Pillow 41962.1/1100000: 4% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos, accelerando(2)
4:43.829 default L service_imp Fluffy_Pillow 60327.2/1100000: 5% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando(2)
4:44.932 default E immolate Fluffy_Pillow 76863.4/1100000: 7% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos, accelerando(2)
4:46.036 default S life_tap Fluffy_Pillow 27414.5/1100000: 2% mana | 0.0/5: 0% soul_shard lord_of_flames, accelerando(2)
4:47.142 default G immolate Fluffy_Pillow 373995.6/1100000: 34% mana | 0.0/5: 0% soul_shard lord_of_flames, accelerando(2)
4:48.250 default C havoc enemy2 324606.7/1100000: 30% mana | 1.0/5: 20% soul_shard lord_of_flames, accelerando(2)
4:49.353 default J conflagrate Fluffy_Pillow 253142.9/1100000: 23% mana | 1.0/5: 20% soul_shard lord_of_flames, accelerando(2)
4:50.458 default Q chaos_bolt Fluffy_Pillow 269658.1/1100000: 25% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos
4:52.728 default Q chaos_bolt Fluffy_Pillow 302717.7/1100000: 28% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
4:54.073 default R incinerate Fluffy_Pillow 322593.2/1100000: 29% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
4:55.398 default R incinerate Fluffy_Pillow 276457.6/1100000: 25% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
4:56.724 default J conflagrate Fluffy_Pillow 230338.3/1100000: 21% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
4:57.812 default R incinerate Fluffy_Pillow 246883.8/1100000: 22% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando(3)
4:59.119 default R incinerate Fluffy_Pillow 200759.7/1100000: 18% mana | 1.0/5: 20% soul_shard lord_of_flames, accelerando(3)
5:00.426 default R incinerate Fluffy_Pillow 154636.7/1100000: 14% mana | 1.0/5: 20% soul_shard lord_of_flames, accelerando(4)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4201 3876 0
Agility 7254 6929 0
Stamina 52634 52634 34229
Intellect 50379 48673 39032 (1278)
Spirit 1 1 0
Health 3158040 3158040 0
Mana 1100000 1100000 0
Soul Shard 5 5 0
Spell Power 50379 48673 0
Crit 11.78% 11.78% 2713
Haste 32.37% 31.37% 11765
Damage / Heal Versatility 5.96% 5.96% 2829
ManaReg per Second 14561 14451 0
Mastery 67.59% 67.59% 5813
Armor 1979 1979 1979
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 906.00
Local Head Eyes of Azj'Aqir
ilevel: 900, stats: { 253 Armor, +3255 Sta, +2170 Int, +1074 Haste, +578 Vers }
Local Neck Radiant String of Scorpid Eyes
ilevel: 900, stats: { +1831 Sta, +2011 Haste, +922 Crit }, enchant: mark_of_the_hidden_satyr
Local Shoulders Pauldrons of Azj'Aqir
ilevel: 900, stats: { 233 Armor, +2442 Sta, +1628 Int, +752 Mastery, +487 Vers }
Local Chest Robes of Fluctuating Energy
ilevel: 900, stats: { 311 Armor, +3255 Sta, +2170 Int, +1145 Haste, +507 Mastery }
Local Waist Man'ari Skullbuckled Cinch
ilevel: 900, stats: { 175 Armor, +2442 Sta, +1628 Int, +699 Haste, +540 Mastery }
Local Legs Leggings of Azj'Aqir
ilevel: 900, stats: { 272 Armor, +3255 Sta, +2170 Int, +932 Crit, +720 Haste }
Local Feet Norgannon's Foresight
ilevel: 940, stats: { 247 Armor, +3544 Sta, +2362 Int, +822 Haste, +617 Mastery }
Local Wrists Woven Lasher Tendril Bracers
ilevel: 900, stats: { 136 Armor, +1831 Sta, +1221 Int, +644 Haste, +285 Vers }
Local Hands Clutch of Azj'Aqir
ilevel: 900, stats: { 194 Armor, +2442 Sta, +1628 Int, +859 Crit, +380 Mastery }
Local Finger1 Ring of the Scoured Clan
ilevel: 900, stats: { +1831 Sta, +2095 Mastery, +838 Haste }, enchant: { +200 Haste }
Local Finger2 Ring of Braided Stems
ilevel: 905, stats: { +1918 Sta, +1814 Haste, +1209 Vers }, enchant: { +200 Haste }
Local Trinket1 Whispers in the Dark
ilevel: 905, stats: { +2162 Int }
Local Trinket2 Erratic Metronome
ilevel: 900, stats: { +2063 Int }
Local Back Astromancer's Greatcloak
ilevel: 905, stats: { 158 Armor, +1918 Sta, +1278 StrAgiInt, +676 Haste, +270 Vers }, enchant: { +200 Int }
Local Main Hand Scepter of Sargeras
ilevel: 929, weapon: { 7005 - 10509, 3.6 }, stats: { +2843 Int, +4265 Sta, +922 Haste, +922 Mastery, +15509 Int }, relics: { +61 ilevels, +59 ilevels, +61 ilevels }

Talents

Level
15 Backdraft (Destruction Warlock) Roaring Blaze (Destruction Warlock) Shadowburn (Destruction Warlock)
30 Reverse Entropy (Destruction Warlock) Eradication (Destruction Warlock) Empowered Life Tap
45 Demonic Circle Mortal Coil Shadowfury
60 Cataclysm (Destruction Warlock) Fire and Brimstone (Destruction Warlock) Soul Harvest
75 Demon Skin Burning Rush Dark Pact
90 Grimoire of Supremacy Grimoire of Service Grimoire of Sacrifice
100 Wreak Havoc (Destruction Warlock) Channel Demonfire (Destruction Warlock) Soul Conduit

Profile

warlock="Norgannon's"
level=110
race=troll
role=spell
position=back
talents=2203021
artifact=38:142513:142516:142513:0:803:1:804:3:805:3:806:5:807:3:808:3:809:4:810:3:811:3:812:3:813:1:814:1:815:1:816:1:817:1:818:1:1355:1
spec=destruction

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,type=whispered_pact
actions.precombat+=/food,type=azshari_salad
actions.precombat+=/summon_pet,if=!talent.grimoire_of_supremacy.enabled&(!talent.grimoire_of_sacrifice.enabled|buff.demonic_power.down)
actions.precombat+=/summon_infernal,if=talent.grimoire_of_supremacy.enabled&artifact.lord_of_flames.rank>0
actions.precombat+=/summon_infernal,if=talent.grimoire_of_supremacy.enabled&active_enemies>1
actions.precombat+=/summon_doomguard,if=talent.grimoire_of_supremacy.enabled&active_enemies=1&artifact.lord_of_flames.rank=0
actions.precombat+=/augmentation,type=defiled
actions.precombat+=/snapshot_stats
actions.precombat+=/grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
actions.precombat+=/life_tap,if=talent.empowered_life_tap.enabled&!buff.empowered_life_tap.remains
actions.precombat+=/potion,name=prolonged_power
actions.precombat+=/chaos_bolt

# Executed every time the actor is available.
actions=havoc,target=2,if=active_enemies>1&(active_enemies<4|talent.wreak_havoc.enabled&active_enemies<6)&!debuff.havoc.remains
actions+=/dimensional_rift,if=charges=3
actions+=/immolate,if=remains<=tick_time
actions+=/immolate,cycle_targets=1,if=active_enemies>1&remains<=tick_time&(!talent.roaring_blaze.enabled|(!debuff.roaring_blaze.remains&action.conflagrate.charges<2))
actions+=/immolate,if=talent.roaring_blaze.enabled&remains<=duration&!debuff.roaring_blaze.remains&target.time_to_die>10&(action.conflagrate.charges=2+set_bonus.tier19_4pc|(action.conflagrate.charges>=1+set_bonus.tier19_4pc&action.conflagrate.recharge_time<cast_time+gcd)|target.time_to_die<24)
actions+=/berserking
actions+=/blood_fury
actions+=/arcane_torrent
actions+=/potion,name=deadly_grace,if=(buff.soul_harvest.remains|trinket.proc.any.react|target.time_to_die<=45)
actions+=/shadowburn,if=buff.conflagration_of_chaos.remains<=action.chaos_bolt.cast_time
actions+=/shadowburn,if=(charges=1&recharge_time<action.chaos_bolt.cast_time|charges=2)&soul_shard<5
actions+=/conflagrate,if=talent.roaring_blaze.enabled&(charges=2+set_bonus.tier19_4pc|(charges>=1+set_bonus.tier19_4pc&recharge_time<gcd)|target.time_to_die<24)
actions+=/conflagrate,if=talent.roaring_blaze.enabled&debuff.roaring_blaze.stack>0&dot.immolate.remains>dot.immolate.duration*0.3&(active_enemies=1|soul_shard<3)&soul_shard<5
actions+=/conflagrate,if=!talent.roaring_blaze.enabled&!buff.backdraft.remains&buff.conflagration_of_chaos.remains<=action.chaos_bolt.cast_time
actions+=/conflagrate,if=!talent.roaring_blaze.enabled&!buff.backdraft.remains&(charges=1&recharge_time<action.chaos_bolt.cast_time|charges=2)&soul_shard<5
actions+=/life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<=gcd
actions+=/dimensional_rift,if=equipped.144369&!buff.lessons_of_spacetime.remains&((!talent.grimoire_of_supremacy.enabled&!cooldown.summon_doomguard.remains)|(talent.grimoire_of_service.enabled&!cooldown.service_pet.remains)|(talent.soul_harvest.enabled&!cooldown.soul_harvest.remains))
actions+=/service_pet
actions+=/summon_infernal,if=artifact.lord_of_flames.rank>0&!buff.lord_of_flames.remains
actions+=/summon_doomguard,if=!talent.grimoire_of_supremacy.enabled&spell_targets.infernal_awakening<=2&(target.time_to_die>180|target.health.pct<=20|target.time_to_die<30)
actions+=/summon_infernal,if=!talent.grimoire_of_supremacy.enabled&spell_targets.infernal_awakening>2
actions+=/summon_doomguard,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal=1&artifact.lord_of_flames.rank>0&buff.lord_of_flames.remains&!pet.doomguard.active
actions+=/summon_doomguard,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal=1&equipped.132379&!cooldown.sindorei_spite_icd.remains
actions+=/summon_infernal,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal>1&equipped.132379&!cooldown.sindorei_spite_icd.remains
actions+=/soul_harvest
actions+=/channel_demonfire,if=dot.immolate.remains>cast_time
actions+=/havoc,if=active_enemies=1&talent.wreak_havoc.enabled&equipped.132375&!debuff.havoc.remains
actions+=/rain_of_fire,if=active_enemies>=3&cooldown.havoc.remains<=12&!talent.wreak_havoc.enabled
actions+=/rain_of_fire,if=active_enemies>=6&talent.wreak_havoc.enabled
actions+=/dimensional_rift,if=!equipped.144369|charges>1|((!talent.grimoire_of_service.enabled|recharge_time<cooldown.service_pet.remains)&(!talent.soul_harvest.enabled|recharge_time<cooldown.soul_harvest.remains)&(!talent.grimoire_of_supremacy.enabled|recharge_time<cooldown.summon_doomguard.remains))
actions+=/life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<duration*0.3
actions+=/cataclysm
actions+=/chaos_bolt,if=(cooldown.havoc.remains>12&cooldown.havoc.remains|active_enemies<3|talent.wreak_havoc.enabled&active_enemies<6)
actions+=/shadowburn
actions+=/conflagrate,if=!talent.roaring_blaze.enabled&!buff.backdraft.remains
actions+=/immolate,if=!talent.roaring_blaze.enabled&remains<=duration*0.3
actions+=/incinerate
actions+=/life_tap

head=eyes_of_azjaqir,id=138314,bonus_id=3445
neck=radiant_string_of_scorpid_eyes,id=140898,bonus_id=3445,enchant_id=5439
shoulders=pauldrons_of_azjaqir,id=138323,bonus_id=3445
back=astromancers_greatcloak,id=140909,bonus_id=3518,enchant_id=5436
chest=robes_of_fluctuating_energy,id=140848,bonus_id=3445
wrists=woven_lasher_tendril_bracers,id=140886,bonus_id=3445
hands=clutch_of_azjaqir,id=138311,bonus_id=3445
waist=manari_skullbuckled_cinch,id=140887,bonus_id=3445
legs=leggings_of_azjaqir,id=138317,bonus_id=3445
feet=norgannons_foresight,id=132455,ilevel=940
finger1=ring_of_the_scoured_clan,id=140897,bonus_id=3445,enchant=binding_of_haste
finger2=ring_of_braided_stems,id=140896,bonus_id=3518,enchant=binding_of_haste
trinket1=whispers_in_the_dark,id=140809,ilevel=905
trinket2=erratic_metronome,id=140792,ilevel=900
main_hand=scepter_of_sargeras,id=128941,ilevel=929,gem_id=140826/140837/140826,relic_id=3519/3518:3518/3519

# Gear Summary
# gear_ilvl=905.60
# gear_stamina=34229
# gear_intellect=39032
# gear_crit_rating=2713
# gear_haste_rating=11765
# gear_mastery_rating=5813
# gear_versatility_rating=2829
# gear_armor=1979
# set_bonus=tier19_2pc=1
# set_bonus=tier19_4pc=1
default_pet=imp

Portal_Pants : 992409 dps, 580221 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
992408.9 992408.9 0.0 / 0.000% 0.0 / 0.0% 32.2
RPS Out RPS In Primary Resource Waiting APM Active Skill
25381.5 25381.5 Mana 0.00% 49.0 100.0% 100%
Talents
  • 15: Roaring Blaze (Destruction Warlock)
  • 30: Eradication (Destruction Warlock)
  • 60: Soul Harvest
  • 90: Grimoire of Service
  • 100: Wreak Havoc (Destruction Warlock)
  • Talent Calculator
Artifact

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Portal_Pants 992409
Chaos Bolt 325368 32.8% 55.7 5.24sec 1756381 1112311 Direct 106.3 0 920663 920663 100.0%  

Stats details: chaos_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 55.72 106.30 0.00 0.00 1.5790 0.0000 97864446.36 97864446.36 0.00 1112310.86 1112310.86
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 106.30 100.00% 920663.00 581654 1450411 920747.41 859988 988468 97864446 97864446 0.00
 
 

Action details: chaos_bolt

Static Values
  • id:116858
  • school:chromatic
  • resource:soul_shard
  • range:40.0
  • travel_speed:16.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:2.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:116858
  • name:Chaos Bolt
  • school:chromatic
  • tooltip:
  • description:Unleashes a devastating blast of chaos, causing {$s1=1} Chaos damage. Chaos Bolt always critically strikes and your critical strike chance increases its damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:4.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Conflagrate 108321 10.9% 47.0 6.39sec 692683 647326 Direct 93.4 206548 470293 348433 53.8%  

Stats details: conflagrate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 46.97 93.38 0.00 0.00 1.0701 0.0000 32537175.98 32537175.98 0.00 647325.64 647325.64
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 43.15 46.20% 206547.55 132185 329608 206645.55 180289 237287 8911962 8911962 0.00
crit 50.24 53.80% 470293.48 264371 764169 470429.91 420478 530128 23625214 23625214 0.00
 
 

Action details: conflagrate

Static Values
  • id:17962
  • school:fire
  • resource:chi
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:9.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.roaring_blaze.enabled&(charges=2+set_bonus.tier19_4pc|(charges>=1+set_bonus.tier19_4pc&recharge_time<gcd)|target.time_to_die<24)
Spelldata
  • id:17962
  • name:Conflagrate
  • school:fire
  • tooltip:
  • description:Triggers an explosion on the target, dealing {$s1=1} Fire damage.{$?s196406=false}[ Reduces the cast time of Incinerate and Chaos Bolt by {$117828s1=30}% for {$117828d=10 seconds}.][] |cFFFFFFFFGenerates 1 Soul Shard.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.265510
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Deadly Grace 5150 0.5% 13.8 2.14sec 109782 0 Direct 13.8 94598 189159 109783 16.1%  

Stats details: deadly_grace

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.85 13.85 0.00 0.00 0.0000 0.0000 1520108.74 1520108.74 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 11.62 83.94% 94598.32 83888 100666 94605.22 87244 100666 1099538 1099538 0.00
crit 2.22 16.06% 189158.82 167777 201332 172220.36 0 201332 420571 420571 0.00
 
 

Action details: deadly_grace

Static Values
  • id:188091
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:25.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188091
  • name:Deadly Grace
  • school:arcane
  • tooltip:
  • description:Deal {$s1=63339 to 95008} Arcane damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:63338.72
  • base_dd_max:95008.08
 
Immolate 236433 23.8% 19.6 15.58sec 3619165 3318652 Direct 37.7 142443 284910 210643 47.9%  
Periodic 283.3 150657 300994 222666 47.9% 195.6%

Stats details: immolate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 19.63 37.71 283.34 283.34 1.0906 2.0783 71035755.04 71035755.04 0.00 116396.34 3318652.42
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 19.66 52.13% 142443.38 91712 228623 142481.12 121142 166132 2800467 2800467 0.00
crit 18.05 47.87% 284910.40 183422 457360 284952.52 239161 333919 5143745 5143745 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 147.6 52.10% 150657.03 51 454339 150894.47 129560 181483 22240559 22240559 0.00
crit 135.7 47.90% 300994.41 162 908691 301487.39 254748 361154 40850985 40850985 0.00
 
 

Action details: immolate

Static Values
  • id:348
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:66000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.32
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:remains<=tick_time
Spelldata
  • id:348
  • name:Immolate
  • school:fire
  • tooltip:
  • description:Burns the enemy, causing {$s1=1} Fire damage immediately and an additional $157736o1 Fire damage over {$157736d=18 seconds}. |cFFFFFFFFPeriodic damage has a {$193541s1=15}% chance to generate 1 Soul Shard. Chance doubled on critical strikes.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.332000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.721500
  • base_td:0.00
  • dot_duration:18.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Incinerate 134316 13.6% 76.4 3.75sec 529463 416343 Direct 146.9 237450 474801 275219 15.9%  

Stats details: incinerate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 76.35 146.88 0.00 0.00 1.2717 0.0000 40425259.20 40425259.20 0.00 416343.20 416343.20
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 123.51 84.09% 237450.30 148245 369667 237548.10 220676 252982 29327618 29327618 0.00
crit 23.37 15.91% 474801.31 296493 739329 474938.09 396055 555333 11097641 11097641 0.00
 
 

Action details: incinerate

Static Values
  • id:29722
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:66000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:29722
  • name:Incinerate
  • school:fire
  • tooltip:
  • description:Draws fire toward the enemy, dealing {$s2=0} Fire damage.{$?s29722=true}|!c3[][ Replaces Shadow Bolt.]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.331000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Mark of the Hidden Satyr 8723 0.9% 19.2 15.59sec 136392 0 Direct 19.2 117676 235378 136390 15.9%  

Stats details: mark_of_the_hidden_satyr

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 19.24 19.24 0.00 0.00 0.0000 0.0000 2623680.67 2623680.67 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 16.18 84.10% 117675.66 112204 141587 117704.48 112204 127759 1903685 1903685 0.00
crit 3.06 15.90% 235377.96 224408 283174 224391.36 0 283174 719995 719995 0.00
 
 

Action details: mark_of_the_hidden_satyr

Static Values
  • id:191259
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191259
  • name:Mark of the Hidden Satyr
  • school:fire
  • tooltip:
  • description:Deals fire damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:2.500000
  • spell_power_mod.direct:2.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
pet - imp 41670 / 41670
Firebolt 41670 4.2% 105.2 2.86sec 119018 94639 Direct 104.4 103489 206938 119936 15.9%  

Stats details: firebolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 105.25 104.44 0.00 0.00 1.2576 0.0000 12526530.23 12526530.23 0.00 94639.13 94639.13
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 87.84 84.10% 103489.02 66202 125307 103513.76 100550 106136 9090494 9090494 0.00
crit 16.60 15.90% 206937.92 132403 250614 206992.83 183653 231951 3436036 3436036 0.00
 
 

Action details: firebolt

Static Values
  • id:3110
  • school:fire
  • resource:energy
  • range:40.0
  • travel_speed:16.0000
  • trigger_gcd:0.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.75
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:3110
  • name:Firebolt
  • school:fire
  • tooltip:
  • description:Deals {$s1=1} Fire damage to a target.$?a231795[ Damage increased by {$231795s1=50}% if you have Immolated the target.][] |cFF777777(Right-Click to toggle)|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
pet - service_imp 119727 / 38184
Firebolt 119727 3.8% 46.9 5.79sec 243923 207183 Direct 46.6 211640 423317 245282 15.9%  

Stats details: firebolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 46.90 46.64 0.00 0.00 1.1773 0.0000 11439387.77 11439387.77 0.00 207182.74 207182.74
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 39.22 84.11% 211639.81 132403 250614 211856.05 201853 220855 8301411 8301411 0.00
crit 7.41 15.89% 423317.13 264807 501227 423409.67 0 501227 3137977 3137977 0.00
 
 

Action details: firebolt

Static Values
  • id:3110
  • school:fire
  • resource:energy
  • range:40.0
  • travel_speed:16.0000
  • trigger_gcd:0.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.75
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:3110
  • name:Firebolt
  • school:fire
  • tooltip:
  • description:Deals {$s1=1} Fire damage to a target.$?a231795[ Damage increased by {$231795s1=50}% if you have Immolated the target.][] |cFF777777(Right-Click to toggle)|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
pet - infernal 114142 / 9665
Immolation 88921 0.7% 1.0 0.00sec 2223109 0 Periodic 44.9 42710 85387 49511 15.9% 8.1%

Stats details: immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 22.45 44.90 0.0000 1.0827 2223109.06 2223109.06 0.00 91463.39 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 37.7 84.06% 42710.17 36872 44246 42716.89 41502 43868 1612084 1612084 0.00
crit 7.2 15.94% 85387.25 73743 88492 85373.48 0 88492 611025 611025 0.00
 
 

Action details: immolation

Static Values
  • id:19483
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!ticking
Spelldata
  • id:19483
  • name:Immolation
  • school:fire
  • tooltip:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
 

Action details: immolation_tick

Static Values
  • id:20153
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all enemies near the caster.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
melee 25221 0.2% 21.3 1.15sec 29662 26018 Direct 21.3 25573 51177 29662 16.0%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 21.26 21.26 0.00 0.00 1.1400 0.0000 630549.47 926967.45 31.98 26018.13 26018.13
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 17.86 84.03% 25572.61 22049 26459 25573.96 24763 26459 456798 671537 31.98
crit 3.40 15.97% 51176.57 44099 52918 49803.97 0 52918 173751 255431 31.12
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
pet - doomguard 92506 / 7829
Doom Bolt 92506 0.8% 10.4 2.27sec 221800 99466 Direct 10.4 191521 382803 221813 15.8%  

Stats details: doom_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.43 10.43 0.00 0.00 2.2299 0.0000 2312691.96 2312691.96 0.00 99466.34 99466.34
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 8.78 84.16% 191521.08 185138 222165 191521.97 185138 222165 1680664 1680664 0.00
crit 1.65 15.84% 382802.81 370276 444331 318657.91 0 444331 632028 632028 0.00
 
 

Action details: doom_bolt

Static Values
  • id:85692
  • school:shadow
  • resource:energy
  • range:30.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:35.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:85692
  • name:Doom Bolt
  • school:shadow
  • tooltip:
  • description:Sends a shadowy bolt at the enemy, causing {$s1=1} Shadow damage. Deals {$s2=20}% additional damage to targets below 20% health.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
pet - lord_of_flames_infernal 114055 / 9657
Immolation 88871 0.7% 1.0 0.00sec 2221858 0 Periodic 44.9 42707 85421 49484 15.9% 8.1%

Stats details: immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 22.45 44.90 0.0000 1.0827 2221857.52 2221857.52 0.00 91411.89 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 37.8 84.13% 42706.97 36872 44246 42714.09 41564 43812 1613335 1613335 0.00
crit 7.1 15.87% 85421.10 73743 88492 85380.77 0 88492 608522 608522 0.00
 
 

Action details: immolation

Static Values
  • id:19483
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!ticking
Spelldata
  • id:19483
  • name:Immolation
  • school:fire
  • tooltip:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
 

Action details: immolation_tick

Static Values
  • id:20153
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all enemies near the caster.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
melee 25185 0.2% 21.3 1.15sec 29619 25981 Direct 21.3 25578 51116 29619 15.8%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 21.26 21.26 0.00 0.00 1.1400 0.0000 629639.19 925629.25 31.98 25980.57 25980.57
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 17.89 84.18% 25578.29 22049 26459 25579.94 24884 26459 457709 672875 31.98
crit 3.36 15.82% 51116.38 44099 52918 49752.58 0 52918 171931 252754 31.12
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
pet - lord_of_flames_infernal 114106 / 9660
Immolation 88860 0.7% 1.0 0.00sec 2221582 0 Periodic 44.9 42708 85408 49477 15.9% 8.1%

Stats details: immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 22.45 44.90 0.0000 1.0827 2221582.43 2221582.43 0.00 91400.58 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 37.8 84.15% 42708.20 36872 44246 42714.92 41564 43858 1613611 1613611 0.00
crit 7.1 15.85% 85408.07 73743 88492 85412.19 0 88492 607972 607972 0.00
 
 

Action details: immolation

Static Values
  • id:19483
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!ticking
Spelldata
  • id:19483
  • name:Immolation
  • school:fire
  • tooltip:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
 

Action details: immolation_tick

Static Values
  • id:20153
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all enemies near the caster.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
melee 25247 0.2% 21.3 1.15sec 29692 26045 Direct 21.3 25573 51169 29692 16.1%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 21.26 21.26 0.00 0.00 1.1400 0.0000 631191.62 927911.46 31.98 26044.63 26044.63
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 17.84 83.91% 25573.35 22049 26459 25574.59 24695 26459 456156 670593 31.98
crit 3.42 16.09% 51168.57 44099 52918 49874.80 0 52918 175035 257319 31.17
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
pet - lord_of_flames_infernal 114080 / 9659
Immolation 88857 0.7% 1.0 0.00sec 2221518 0 Periodic 44.9 42707 85421 49476 15.8% 8.1%

Stats details: immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 22.45 44.90 0.0000 1.0827 2221517.53 2221517.53 0.00 91397.91 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 37.8 84.15% 42706.96 36872 44246 42713.54 41643 43836 1613675 1613675 0.00
crit 7.1 15.85% 85421.24 73743 88492 85404.68 0 88492 607842 607842 0.00
 
 

Action details: immolation

Static Values
  • id:19483
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!ticking
Spelldata
  • id:19483
  • name:Immolation
  • school:fire
  • tooltip:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
 

Action details: immolation_tick

Static Values
  • id:20153
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all enemies near the caster.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
melee 25223 0.2% 21.3 1.15sec 29664 26020 Direct 21.3 25574 51167 29664 16.0%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 21.26 21.26 0.00 0.00 1.1400 0.0000 630591.37 927029.05 31.98 26019.86 26019.86
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 17.86 84.02% 25573.54 22049 26459 25574.93 24695 26459 456756 671475 31.98
crit 3.40 15.98% 51166.74 44099 52918 49893.98 0 52918 173835 255554 31.18
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
pet - shadowy_tear 119668 / 20277
Shadow Bolt 119668 2.0% 4.4 59.37sec 1386801 0 Periodic 46.3 113006 225856 130970 15.9% 19.7%

Stats details: shadow_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.37 0.00 46.57 46.30 0.0000 1.2768 6064215.19 6064215.19 0.00 101993.29 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 38.9 84.08% 113006.13 61 136143 112780.01 0 136143 4399617 4399617 0.00
crit 7.4 15.92% 225855.60 139 272285 222666.67 0 272285 1664598 1664598 0.00
 
 

Action details: shadow_bolt

Static Values
  • id:196657
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:196657
  • name:Shadow Bolt
  • school:shadow
  • tooltip:
  • description:Sends a shadowy bolt at the enemy, causing {$s1=1} Shadow damage.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:14.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
pet - chaos_tear 141122 / 9663
Chaos Bolt 141122 1.0% 4.3 59.18sec 669610 326893 Direct 4.3 0 674220 674220 100.0%  

Stats details: chaos_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.32 4.29 0.00 0.00 2.0485 0.0000 2895619.72 2895619.72 0.00 326893.17 326893.17
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 4.29 100.00% 674219.71 625310 789061 674612.36 0 789061 2895620 2895620 0.00
 
 

Action details: chaos_bolt

Static Values
  • id:215279
  • school:chromatic
  • resource:none
  • range:100.0
  • travel_speed:16.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:5.500
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:215279
  • name:Chaos Bolt
  • school:chromatic
  • tooltip:
  • description:Unleashes a devastating blast of chaos, causing {$s1=1} Chaos damage. Chaos Bolt always critically strikes and your critical strike chance increases its damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:5.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
pet - chaos_portal 244357 / 18186
Chaos Barrage 244357 1.8% 4.3 59.77sec 1254298 0 Periodic 146.8 31955 63867 37029 15.9% 7.8%

Stats details: chaos_barrage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.33 0.00 147.59 146.84 0.0000 0.1596 5437355.17 5437355.17 0.00 230807.16 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 123.5 84.10% 31954.71 126 37440 31900.69 0 37440 3946024 3946024 0.00
crit 23.4 15.90% 63866.92 253 74880 63769.43 0 74880 1491332 1491332 0.00
 
 

Action details: chaos_barrage

Static Values
  • id:187394
  • school:magic
  • resource:none
  • range:100.0
  • travel_speed:24.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:187394
  • name:Chaos Barrage
  • school:magic
  • tooltip:
  • description:Deals {$s1=1} Chaos damage.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:5.50
  • base_tick_time:0.25
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Simple Action Stats Execute Interval
Portal_Pants
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Portal_Pants
  • harmful:false
  • if_expr:
 
Berserking 2.1 180.58sec

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.07 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=15}%.
  • description:Increases your haste by {$s1=15}% for {$d=10 seconds}.
 
Dimensional Rift 13.0 23.53sec

Stats details: dimensional_rift

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.97 0.00 0.00 0.00 1.0432 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: dimensional_rift

Static Values
  • id:196586
  • school:none
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:45.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:charges=3
Spelldata
  • id:196586
  • name:Dimensional Rift
  • school:chaos
  • tooltip:
  • description:Rips a hole in time and space, opening a portal that damages your target.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Portal_Pants
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Portal_Pants
  • harmful:false
  • if_expr:
 
Havoc 14.9 20.94sec

Stats details: havoc

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.87 0.00 0.00 0.00 1.1083 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: havoc

Static Values
  • id:80240
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:88000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies>1&(active_enemies<4|talent.wreak_havoc.enabled&active_enemies<6)&!debuff.havoc.remains
Spelldata
  • id:80240
  • name:Havoc
  • school:shadow
  • tooltip:Spells cast by the Warlock also hit this target.
  • description:Marks a target with Havoc for {$d=8 seconds}, causing your single target spells to also strike the Havoc victim. Limit 1.
 
Life Tap 7.2 31.55sec

Stats details: life_tap

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.23 0.00 0.00 0.00 1.0879 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: life_tap

Static Values
  • id:1454
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.empowered_life_tap.enabled&!buff.empowered_life_tap.remains
Spelldata
  • id:1454
  • name:Life Tap
  • school:shadow
  • tooltip:
  • description:Restores {$s1=30}% of your maximum mana, at the cost of {$s2=10}% of your maximum health.
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Grimoire: Imp (service_imp) 3.7 91.85sec

Stats details: service_imp

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.67 0.00 0.00 0.00 1.0031 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: service_imp

Static Values
  • id:111859
  • school:shadow
  • resource:soul_shard
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:90.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:111859
  • name:Grimoire: Imp
  • school:shadow
  • tooltip:
  • description:Summons an Imp who attacks the target for {$108501s1=25} sec. Imps cast ranged Firebolts and cleanse a hostile magic effect from their master.
 
Soul Harvest 2.9 120.99sec

Stats details: soul_harvest

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.89 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: soul_harvest

Static Values
  • id:196098
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:196098
  • name:Soul Harvest
  • school:shadow
  • tooltip:Damage increased by {$s1=20}%.
  • description:Increases your damage and your pets' damage by {$s1=20}%. Lasts {$d=15 seconds}, increased by {$s2=2} sec for each target afflicted by your {$?s137043=false}[Agony][]{$?s137044=false}[Doom][]{$?s137046=false}[Immolate][], up to a maximum of {$s3=35} sec.
 
Summon Doomguard 1.0 0.00sec

Stats details: summon_doomguard

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 1.1180 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_doomguard

Static Values
  • id:18540
  • school:shadow
  • resource:soul_shard
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.grimoire_of_supremacy.enabled&active_enemies=1&artifact.lord_of_flames.rank=0
Spelldata
  • id:18540
  • name:Summon Doomguard
  • school:shadow
  • tooltip:
  • description:Summons a Doomguard for {$60478d=25 seconds} to assault the target with its Doom Bolts.
 
Summon Imp 1.0 0.00sec

Stats details: summon_imp

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_imp

Static Values
  • id:688
  • school:shadow
  • resource:soul_shard
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!talent.grimoire_of_supremacy.enabled&(!talent.grimoire_of_sacrifice.enabled|buff.demonic_power.down)
Spelldata
  • id:688
  • name:Summon Imp
  • school:shadow
  • tooltip:
  • description:Summons an Imp under your command that casts ranged Firebolts.$?s74434[ |cFFFFFFFFSoulburn:|r |cFF8282FFInstant cast.|r][]
 
Summon Infernal 1.0 0.00sec

Stats details: summon_infernal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.7757 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_infernal

Static Values
  • id:1122
  • school:shadow
  • resource:soul_shard
  • range:30.0
  • travel_speed:1.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.grimoire_of_supremacy.enabled&artifact.lord_of_flames.rank>0
Spelldata
  • id:1122
  • name:Summon Infernal
  • school:shadow
  • tooltip:
  • description:Summons an Infernal from the Twisting Nether, impacting for {$22703s1=0} Fire damage and stunning all enemy targets in the area for {$22703d=2 seconds}. The Infernal will serve you for {$111685d=25 seconds}, dealing strong area-of-effect damage.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Accelerando 20.0 0.0 15.4sec 15.4sec 78.28% 78.28% 1.4(1.4) 19.3

Buff details

  • buff initial source:Portal_Pants
  • cooldown name:buff_accelerando
  • max_stacks:5
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:734.41

Stack Uptimes

  • accelerando_1:29.70%
  • accelerando_2:24.53%
  • accelerando_3:14.64%
  • accelerando_4:6.54%
  • accelerando_5:2.87%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225719
  • name:Accelerando
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc225125=Your damaging spells have a chance to grant you {$225719s1=528} Haste for {$225719d=12 seconds}, stacking up to 5 times. Stacking does not refresh duration.}
  • max_stacks:5
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Berserking 2.1 0.0 180.6sec 180.6sec 6.87% 8.28% 0.0(0.0) 2.0

Buff details

  • buff initial source:Portal_Pants
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:10.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • berserking_1:6.87%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=15}%.
  • description:Increases your haste by {$s1=15}% for {$d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.55% 15.42% 0.0(0.0) 1.0

Buff details

  • buff initial source:Portal_Pants
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:13.55%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Conflagration of Chaos 23.5 0.0 12.7sec 12.7sec 48.88% 45.10% 0.0(0.0) 1.8

Buff details

  • buff initial source:Portal_Pants
  • cooldown name:buff_conflagration_of_chaos
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:50.00%
  • default_value:-0.00

Stack Uptimes

  • conflagration_of_chaos_1:48.88%

Trigger Attempt Success

  • trigger_pct:50.01%

Spelldata details

  • id:196546
  • name:Conflagration of Chaos
  • tooltip:Your {$?s17877=false}[Shadowburn][Conflagrate] will always critically strike. Critical strike chance will increase the critical strike damage of {$?s17877=false}[Shadowburn][Conflagrate].
  • description:{$@spelldesc219195={$?s17877=false}[Shadowburn][Conflagrate] has a chance to guarantee your next {$?s17877=false}[Shadowburn][Conflagrate] critically strikes, and to increase its damage by your critical strike chance.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Devil's Due 3.5 0.0 69.7sec 69.7sec 8.72% 10.31% 0.0(0.0) 3.2

Buff details

  • buff initial source:Portal_Pants
  • cooldown name:buff_devils_due
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.18

Stack Uptimes

  • devils_due_1:8.72%

Trigger Attempt Success

  • trigger_pct:99.88%

Spelldata details

  • id:225776
  • name:Devil's Due
  • tooltip:Cast speed slowed by {$s1=7}%.
  • description:{$@spelldesc225142=Your damaging spells have a chance to grant Nefarious Pact, increasing your casting speed by {$225774s1=17}% for {$225774d=12 seconds}. When Nefarious Pact expires, your casting speed is decreased by {$225776s1=7}% for {$225776d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Embrace Chaos 26.4 30.3 11.6sec 5.2sec 58.08% 65.50% 30.3(30.3) 25.8

Buff details

  • buff initial source:Portal_Pants
  • cooldown name:buff_embrace_chaos
  • max_stacks:1
  • duration:4.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • embrace_chaos_1:58.08%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:212019
  • name:Embrace Chaos
  • tooltip:Chaos Bolt has {$s1=40}% reduced cast time.
  • description:{$@spelldesc212018=Casting Chaos Bolt reduces the cast time of your next Chaos Bolt by {$212019s1=40}% for {$212019d=4 seconds}.}
  • max_stacks:0
  • duration:4.00
  • cooldown:0.00
  • default_chance:0.00%
Lord of Flames 1.0 0.0 0.0sec 0.0sec 97.81% 97.81% 0.0(0.0) 0.0

Buff details

  • buff initial source:Portal_Pants
  • cooldown name:buff_lord_of_flames
  • max_stacks:1
  • duration:600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • lord_of_flames_1:97.81%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:226802
  • name:Lord of Flames
  • tooltip:Recently activated Lord of Flames.
  • description:{$@spelldesc224103=Once every {$s2=10} minutes, {$?s152107=false}[your Infernal's Meteor Strike][Summon Infernal] will summon {$s3=3} additional Infernals to serve you for {$226804d=25 seconds}.}
  • max_stacks:0
  • duration:600.00
  • cooldown:0.00
  • default_chance:0.00%
Nefarious Pact 3.5 0.0 70.1sec 69.5sec 13.56% 15.05% 0.0(0.0) 3.3

Buff details

  • buff initial source:Portal_Pants
  • cooldown name:buff_nefarious_pact
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.44

Stack Uptimes

  • nefarious_pact_1:13.56%

Trigger Attempt Success

  • trigger_pct:99.88%

Spelldata details

  • id:225774
  • name:Nefarious Pact
  • tooltip:Cast speed increased by {$s1=17}%.
  • description:{$@spelldesc225142=Your damaging spells have a chance to grant Nefarious Pact, increasing your casting speed by {$225774s1=17}% for {$225774d=12 seconds}. When Nefarious Pact expires, your casting speed is decreased by {$225776s1=7}% for {$225776d=8 seconds}.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of Deadly Grace 1.0 0.0 0.0sec 0.0sec 10.16% 10.16% 0.0(0.0) 1.0

Buff details

  • buff initial source:Portal_Pants
  • cooldown name:buff_potion_of_deadly_grace
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_deadly_grace_1:10.16%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188027
  • name:Potion of Deadly Grace
  • tooltip:Your attacks have a chance to unleash a bolt of energy at your target.
  • description:Grants your attacks a chance to unleash a bolt of energy at your target. Staying away from enemies for the entire duration of the effect will extend the effect by an additional 5 seconds.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
Potion of Prolonged Power 1.0 0.0 0.0sec 0.0sec 19.64% 19.64% 0.0(0.0) 1.0

Buff details

  • buff initial source:Portal_Pants
  • cooldown name:buff_potion_of_prolonged_power
  • max_stacks:1
  • duration:60.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:all
  • amount:2500.00

Stack Uptimes

  • potion_of_prolonged_power_1:19.64%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:229206
  • name:Potion of Prolonged Power
  • tooltip:All stats increased by {$s1=2500}.
  • description:Drink to increase all stats by {$s1=2500} for {$d=60 seconds}.
  • max_stacks:0
  • duration:60.00
  • cooldown:1.00
  • default_chance:0.00%
Soul Harvest 2.9 0.0 121.0sec 121.0sec 17.74% 17.74% 0.0(0.0) 2.7

Buff details

  • buff initial source:Portal_Pants
  • cooldown name:buff_soul_harvest
  • max_stacks:1
  • duration:15.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • soul_harvest_1:17.74%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:196098
  • name:Soul Harvest
  • tooltip:Damage increased by {$s1=20}%.
  • description:Increases your damage and your pets' damage by {$s1=20}%. Lasts {$d=15 seconds}, increased by {$s2=2} sec for each target afflicted by your {$?s137043=false}[Agony][]{$?s137044=false}[Doom][]{$?s137046=false}[Immolate][], up to a maximum of {$s3=35} sec.
  • max_stacks:0
  • duration:15.00
  • cooldown:120.00
  • default_chance:0.00%
Constant Buffs
Well Fed (azshari_salad)

Buff details

  • buff initial source:Portal_Pants
  • cooldown name:buff_azshari_salad
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:375.00

Stack Uptimes

  • azshari_salad_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225603
  • name:Well Fed
  • tooltip:Haste increased by $w1.
  • description:Increases haste by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Defiled Augmentation

Buff details

  • buff initial source:Portal_Pants
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Whispered Pact

Buff details

  • buff initial source:Portal_Pants
  • cooldown name:buff_flask_of_the_whispered_pact
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:1300.00

Stack Uptimes

  • flask_of_the_whispered_pact_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188031
  • name:Flask of the Whispered Pact
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%

Procs

Count Interval
shadowy_tear 4.3 59.6sec
chaos_tear 4.3 59.4sec
chaos_portal 4.3 59.8sec
dimension_ripper 3.8 55.8sec

Resources

Resource Usage Type Count Total Average RPE APR
Portal_Pants
chaos_bolt Soul Shard 56.7 113.4 2.0 2.0 862722.4
havoc Mana 14.9 1308281.9 88000.0 87999.1 0.0
immolate Mana 19.6 1295429.0 66000.0 66000.2 54.8
incinerate Mana 76.4 5039185.4 66000.0 65999.9 8.0
service_imp Soul Shard 3.7 3.7 1.0 1.0 0.0
summon_doomguard Soul Shard 1.0 1.0 1.0 1.0 0.0
summon_infernal Soul Shard 1.0 1.0 1.0 1.0 0.0
pet - imp
firebolt Energy 105.2 4210.0 40.0 40.0 2975.5
pet - service_imp
firebolt Energy 46.9 1875.9 40.0 40.0 6098.0
pet - doomguard
doom_bolt Energy 10.4 364.9 35.0 35.0 6337.1
Resource Gains Type Count Total Average Overflow
life_tap Mana 7.23 2387262.82 (35.23%) 330000.00 0.00 0.00%
immolate Soul Shard 62.93 62.40 (52.96%) 0.99 0.53 0.84%
conflagrate Soul Shard 46.97 46.92 (39.82%) 1.00 0.06 0.12%
mp5_regen Mana 461.95 4389079.36 (64.77%) 9501.26 85327.75 1.91%
soulsnatcher Soul Shard 8.51 8.51 (7.22%) 1.00 0.00 0.00%
pet - imp
energy_regen Energy 1894.95 4043.57 (100.00%) 2.13 21.58 0.53%
pet - service_imp
energy_regen Energy 435.28 1277.44 (100.00%) 2.93 61.65 4.60%
pet - doomguard
energy_regen Energy 15.08 323.98 (100.00%) 21.49 42.42 11.58%
Resource RPS-Gain RPS-Loss
Health 0.00 7730.93
Mana 22503.66 25381.46
Soul Shard 0.39 0.40
Combat End Resource Mean Min Max
Mana 231295.26 6831.22 490663.32
Soul Shard 1.71 0.00 5.00

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 1.4%

Statistics & Data Analysis

Fight Length
Sample Data Portal_Pants Fight Length
Count 9999
Mean 301.12
Minimum 221.26
Maximum 379.15
Spread ( max - min ) 157.89
Range [ ( max - min ) / 2 * 100% ] 26.22%
DPS
Sample Data Portal_Pants Damage Per Second
Count 9999
Mean 992408.95
Minimum 867470.17
Maximum 1155717.85
Spread ( max - min ) 288247.67
Range [ ( max - min ) / 2 * 100% ] 14.52%
Priority Target DPS
Sample Data Portal_Pants Priority Target Damage Per Second
Count 9999
Mean 580220.84
Minimum 510065.52
Maximum 682826.36
Spread ( max - min ) 172760.83
Range [ ( max - min ) / 2 * 100% ] 14.89%
DPS(e)
Sample Data Portal_Pants Damage Per Second (Effective)
Count 9999
Mean 992408.95
Minimum 867470.17
Maximum 1155717.85
Spread ( max - min ) 288247.67
Range [ ( max - min ) / 2 * 100% ] 14.52%
Damage
Sample Data Portal_Pants Damage
Count 9999
Mean 246006425.99
Minimum 171679133.56
Maximum 330153034.97
Spread ( max - min ) 158473901.41
Range [ ( max - min ) / 2 * 100% ] 32.21%
DTPS
Sample Data Portal_Pants Damage Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Portal_Pants Healing Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS(e)
Sample Data Portal_Pants Healing Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Portal_Pants Heal
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Portal_Pants Healing Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Portal_Pants Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
ETMI
Sample Data Portal_PantsTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data Portal_Pants Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=whispered_pact
1 0.00 food,type=azshari_salad
2 0.00 summon_pet,if=!talent.grimoire_of_supremacy.enabled&(!talent.grimoire_of_sacrifice.enabled|buff.demonic_power.down)
3 0.00 summon_infernal,if=talent.grimoire_of_supremacy.enabled&artifact.lord_of_flames.rank>0
4 0.00 summon_infernal,if=talent.grimoire_of_supremacy.enabled&active_enemies>1
5 0.00 summon_doomguard,if=talent.grimoire_of_supremacy.enabled&active_enemies=1&artifact.lord_of_flames.rank=0
6 0.00 augmentation,type=defiled
7 0.00 snapshot_stats
8 0.00 grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
9 0.00 life_tap,if=talent.empowered_life_tap.enabled&!buff.empowered_life_tap.remains
A 0.00 potion,name=prolonged_power
B 0.00 chaos_bolt
Default action list Executed every time the actor is available.
# count action,conditions
C 14.87 havoc,target=2,if=active_enemies>1&(active_enemies<4|talent.wreak_havoc.enabled&active_enemies<6)&!debuff.havoc.remains
D 1.00 dimensional_rift,if=charges=3
E 10.16 immolate,if=remains<=tick_time
F 0.76 immolate,cycle_targets=1,if=active_enemies>1&remains<=tick_time&(!talent.roaring_blaze.enabled|(!debuff.roaring_blaze.remains&action.conflagrate.charges<2))
G 8.76 immolate,if=talent.roaring_blaze.enabled&remains<=duration&!debuff.roaring_blaze.remains&target.time_to_die>10&(action.conflagrate.charges=2+set_bonus.tier19_4pc|(action.conflagrate.charges>=1+set_bonus.tier19_4pc&action.conflagrate.recharge_time<cast_time+gcd)|target.time_to_die<24)
H 2.07 berserking
0.00 blood_fury
0.00 arcane_torrent
I 1.00 potion,name=deadly_grace,if=(buff.soul_harvest.remains|trinket.proc.any.react|target.time_to_die<=45)
0.00 shadowburn,if=buff.conflagration_of_chaos.remains<=action.chaos_bolt.cast_time
0.00 shadowburn,if=(charges=1&recharge_time<action.chaos_bolt.cast_time|charges=2)&soul_shard<5
J 13.56 conflagrate,if=talent.roaring_blaze.enabled&(charges=2+set_bonus.tier19_4pc|(charges>=1+set_bonus.tier19_4pc&recharge_time<gcd)|target.time_to_die<24)
K 33.42 conflagrate,if=talent.roaring_blaze.enabled&debuff.roaring_blaze.stack>0&dot.immolate.remains>dot.immolate.duration*0.3&(active_enemies=1|soul_shard<3)&soul_shard<5
0.00 conflagrate,if=!talent.roaring_blaze.enabled&!buff.backdraft.remains&buff.conflagration_of_chaos.remains<=action.chaos_bolt.cast_time
0.00 conflagrate,if=!talent.roaring_blaze.enabled&!buff.backdraft.remains&(charges=1&recharge_time<action.chaos_bolt.cast_time|charges=2)&soul_shard<5
0.00 life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<=gcd
0.00 dimensional_rift,if=equipped.144369&!buff.lessons_of_spacetime.remains&((!talent.grimoire_of_supremacy.enabled&!cooldown.summon_doomguard.remains)|(talent.grimoire_of_service.enabled&!cooldown.service_pet.remains)|(talent.soul_harvest.enabled&!cooldown.soul_harvest.remains))
L 3.67 service_pet
M 1.00 summon_infernal,if=artifact.lord_of_flames.rank>0&!buff.lord_of_flames.remains
N 1.00 summon_doomguard,if=!talent.grimoire_of_supremacy.enabled&spell_targets.infernal_awakening<=2&(target.time_to_die>180|target.health.pct<=20|target.time_to_die<30)
0.00 summon_infernal,if=!talent.grimoire_of_supremacy.enabled&spell_targets.infernal_awakening>2
0.00 summon_doomguard,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal=1&artifact.lord_of_flames.rank>0&buff.lord_of_flames.remains&!pet.doomguard.active
0.00 summon_doomguard,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal=1&equipped.132379&!cooldown.sindorei_spite_icd.remains
0.00 summon_infernal,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal>1&equipped.132379&!cooldown.sindorei_spite_icd.remains
O 2.90 soul_harvest
0.00 channel_demonfire,if=dot.immolate.remains>cast_time
0.00 havoc,if=active_enemies=1&talent.wreak_havoc.enabled&equipped.132375&!debuff.havoc.remains
0.00 rain_of_fire,if=active_enemies>=3&cooldown.havoc.remains<=12&!talent.wreak_havoc.enabled
0.00 rain_of_fire,if=active_enemies>=6&talent.wreak_havoc.enabled
P 11.97 dimensional_rift,if=!equipped.144369|charges>1|((!talent.grimoire_of_service.enabled|recharge_time<cooldown.service_pet.remains)&(!talent.soul_harvest.enabled|recharge_time<cooldown.soul_harvest.remains)&(!talent.grimoire_of_supremacy.enabled|recharge_time<cooldown.summon_doomguard.remains))
0.00 life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<duration*0.3
0.00 cataclysm
Q 56.04 chaos_bolt,if=(cooldown.havoc.remains>12&cooldown.havoc.remains|active_enemies<3|talent.wreak_havoc.enabled&active_enemies<6)
0.00 shadowburn
0.00 conflagrate,if=!talent.roaring_blaze.enabled&!buff.backdraft.remains
0.00 immolate,if=!talent.roaring_blaze.enabled&remains<=duration*0.3
R 76.66 incinerate
S 7.23 life_tap

Sample Sequence

0126ABCDEGHJKLKMOPPQKQQQKQQRRRKRCRRQRERRQRGJKQKQRKCQRPRKPQRQRERQQCRRGJQQKQKQKQQRCKPQEQQPQRLPRQGCJQQQKFQKQKQKQRRCEQOIRRQRQRPGJKQKCKQQRSRKQQRERRRCRSRRGJKQKQRKPQRHRLCRKPRRSQERRQRRGJCQKKQKQRRRKQRREPSCFQNRRGJKQKQRKOQCRRKQRRSERRRRRQRPQCSGJJJLQJQQRRJQCREJPQ

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask Portal_Pants 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 1 food Portal_Pants 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 2 summon_imp Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 6 augmentation Portal_Pants 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat A potion Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard potion_of_prolonged_power
0:00.000 precombat B chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard embrace_chaos, accelerando, potion_of_prolonged_power
0:00.000 default C havoc enemy2 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard embrace_chaos, accelerando, potion_of_prolonged_power
0:01.182 default D dimensional_rift Fluffy_Pillow 1033494.2/1100000: 94% mana | 1.0/5: 20% soul_shard bloodlust, embrace_chaos, accelerando, potion_of_prolonged_power
0:02.092 default E immolate Fluffy_Pillow 1050042.3/1100000: 95% mana | 1.0/5: 20% soul_shard bloodlust, embrace_chaos, accelerando, potion_of_prolonged_power
0:03.004 default G immolate Fluffy_Pillow 1000628.1/1100000: 91% mana | 1.0/5: 20% soul_shard bloodlust, embrace_chaos, accelerando(2), potion_of_prolonged_power
0:03.902 default H berserking Fluffy_Pillow 951209.6/1100000: 86% mana | 1.0/5: 20% soul_shard bloodlust, embrace_chaos, accelerando(2), potion_of_prolonged_power
0:03.902 default J conflagrate Fluffy_Pillow 951209.6/1100000: 86% mana | 1.0/5: 20% soul_shard bloodlust, berserking, embrace_chaos, accelerando(2), potion_of_prolonged_power
0:04.685 default K conflagrate Fluffy_Pillow 967836.3/1100000: 88% mana | 2.0/5: 40% soul_shard bloodlust, berserking, accelerando(2), potion_of_prolonged_power
0:05.466 default L service_imp Fluffy_Pillow 984420.6/1100000: 89% mana | 3.0/5: 60% soul_shard bloodlust, berserking, conflagration_of_chaos, accelerando(2), potion_of_prolonged_power
0:06.247 default K conflagrate Fluffy_Pillow 1001004.8/1100000: 91% mana | 2.0/5: 40% soul_shard bloodlust, berserking, conflagration_of_chaos, accelerando(2), potion_of_prolonged_power
0:07.030 default M summon_infernal Fluffy_Pillow 1017631.6/1100000: 93% mana | 3.0/5: 60% soul_shard bloodlust, berserking, conflagration_of_chaos, accelerando(2), potion_of_prolonged_power
0:07.812 default O soul_harvest Fluffy_Pillow 1034237.1/1100000: 94% mana | 2.0/5: 40% soul_shard bloodlust, berserking, lord_of_flames, conflagration_of_chaos, accelerando(2), potion_of_prolonged_power
0:07.812 default P dimensional_rift Fluffy_Pillow 1034237.1/1100000: 94% mana | 2.0/5: 40% soul_shard bloodlust, berserking, soul_harvest, lord_of_flames, conflagration_of_chaos, accelerando(2), potion_of_prolonged_power
0:08.593 default P dimensional_rift Fluffy_Pillow 1050821.4/1100000: 96% mana | 4.0/5: 80% soul_shard bloodlust, berserking, soul_harvest, lord_of_flames, conflagration_of_chaos, accelerando(2), potion_of_prolonged_power
0:09.375 default Q chaos_bolt Fluffy_Pillow 1067426.9/1100000: 97% mana | 4.0/5: 80% soul_shard bloodlust, berserking, soul_harvest, lord_of_flames, conflagration_of_chaos, accelerando(2), potion_of_prolonged_power
0:10.934 default K conflagrate Fluffy_Pillow 1100000.0/1100000: 100% mana | 2.0/5: 40% soul_shard bloodlust, berserking, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(2), potion_of_prolonged_power
0:11.689 default Q chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 4.0/5: 80% soul_shard bloodlust, berserking, soul_harvest, lord_of_flames, embrace_chaos, nefarious_pact, accelerando(2), potion_of_prolonged_power
0:12.443 default Q chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard bloodlust, berserking, soul_harvest, lord_of_flames, embrace_chaos, nefarious_pact, potion_of_prolonged_power
0:13.197 default Q chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard bloodlust, berserking, soul_harvest, lord_of_flames, embrace_chaos, nefarious_pact, potion_of_prolonged_power
0:13.952 default K conflagrate Fluffy_Pillow 1100000.0/1100000: 100% mana | 2.0/5: 40% soul_shard bloodlust, soul_harvest, lord_of_flames, embrace_chaos, nefarious_pact, potion_of_prolonged_power
0:14.706 default Q chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard bloodlust, soul_harvest, lord_of_flames, embrace_chaos, nefarious_pact, potion_of_prolonged_power
0:15.477 default Q chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 2.0/5: 40% soul_shard bloodlust, soul_harvest, lord_of_flames, embrace_chaos, nefarious_pact, accelerando, potion_of_prolonged_power
0:16.234 default R incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/5: 0% soul_shard bloodlust, soul_harvest, lord_of_flames, embrace_chaos, nefarious_pact, accelerando, potion_of_prolonged_power
0:16.992 default R incinerate Fluffy_Pillow 1034072.7/1100000: 94% mana | 0.0/5: 0% soul_shard bloodlust, soul_harvest, lord_of_flames, embrace_chaos, nefarious_pact, accelerando, potion_of_prolonged_power
0:17.750 default R incinerate Fluffy_Pillow 981856.7/1100000: 89% mana | 0.0/5: 0% soul_shard bloodlust, soul_harvest, lord_of_flames, embrace_chaos, nefarious_pact, accelerando, potion_of_prolonged_power
0:18.508 default K conflagrate Fluffy_Pillow 929640.7/1100000: 85% mana | 0.0/5: 0% soul_shard bloodlust, soul_harvest, lord_of_flames, embrace_chaos, nefarious_pact, accelerando, potion_of_prolonged_power
0:19.263 default R incinerate Fluffy_Pillow 943370.1/1100000: 86% mana | 1.0/5: 20% soul_shard bloodlust, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando, potion_of_prolonged_power
0:20.022 default C havoc enemy2 891172.2/1100000: 81% mana | 1.0/5: 20% soul_shard bloodlust, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando, potion_of_prolonged_power
0:20.777 default R incinerate Fluffy_Pillow 816901.6/1100000: 74% mana | 1.0/5: 20% soul_shard bloodlust, soul_harvest, lord_of_flames, conflagration_of_chaos, nefarious_pact, accelerando, potion_of_prolonged_power
0:21.537 default R incinerate Fluffy_Pillow 764721.9/1100000: 70% mana | 1.0/5: 20% soul_shard bloodlust, soul_harvest, lord_of_flames, conflagration_of_chaos, devils_due, accelerando, potion_of_prolonged_power
0:22.824 default Q chaos_bolt Fluffy_Pillow 722125.6/1100000: 66% mana | 2.0/5: 40% soul_shard bloodlust, soul_harvest, lord_of_flames, conflagration_of_chaos, devils_due, accelerando, potion_of_prolonged_power
0:24.966 default R incinerate Fluffy_Pillow 761077.1/1100000: 69% mana | 0.0/5: 0% soul_shard bloodlust, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due, accelerando, potion_of_prolonged_power
0:26.252 default E immolate Fluffy_Pillow 718487.8/1100000: 65% mana | 0.0/5: 0% soul_shard bloodlust, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due, accelerando(2), potion_of_prolonged_power
0:27.309 default R incinerate Fluffy_Pillow 672005.2/1100000: 61% mana | 1.0/5: 20% soul_shard bloodlust, lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due, accelerando(2), potion_of_prolonged_power
0:28.576 default R incinerate Fluffy_Pillow 628781.2/1100000: 57% mana | 1.0/5: 20% soul_shard bloodlust, lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due, potion_of_prolonged_power
0:29.883 default Q chaos_bolt Fluffy_Pillow 586183.9/1100000: 53% mana | 3.0/5: 60% soul_shard bloodlust, lord_of_flames, conflagration_of_chaos, accelerando, potion_of_prolonged_power
0:31.701 default R incinerate Fluffy_Pillow 619243.5/1100000: 56% mana | 1.0/5: 20% soul_shard bloodlust, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando, potion_of_prolonged_power
0:32.794 default G immolate Fluffy_Pillow 573119.4/1100000: 52% mana | 1.0/5: 20% soul_shard bloodlust, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando, potion_of_prolonged_power
0:33.708 default J conflagrate Fluffy_Pillow 523740.1/1100000: 48% mana | 1.0/5: 20% soul_shard bloodlust, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando, potion_of_prolonged_power
0:34.619 default K conflagrate Fluffy_Pillow 540306.3/1100000: 49% mana | 2.0/5: 40% soul_shard bloodlust, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando, potion_of_prolonged_power
0:35.530 default Q chaos_bolt Fluffy_Pillow 556872.5/1100000: 51% mana | 3.0/5: 60% soul_shard bloodlust, lord_of_flames, embrace_chaos, accelerando, potion_of_prolonged_power
0:36.622 default K conflagrate Fluffy_Pillow 576730.2/1100000: 52% mana | 1.0/5: 20% soul_shard bloodlust, lord_of_flames, embrace_chaos, accelerando, potion_of_prolonged_power
0:37.533 default Q chaos_bolt Fluffy_Pillow 593439.6/1100000: 54% mana | 3.0/5: 60% soul_shard bloodlust, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2), potion_of_prolonged_power
0:38.609 default R incinerate Fluffy_Pillow 613309.0/1100000: 56% mana | 1.0/5: 20% soul_shard bloodlust, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3), potion_of_prolonged_power
0:39.669 default K conflagrate Fluffy_Pillow 567178.5/1100000: 52% mana | 1.0/5: 20% soul_shard bloodlust, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3), potion_of_prolonged_power
0:40.631 default C havoc enemy2 585211.0/1100000: 53% mana | 2.0/5: 40% soul_shard bloodlust, lord_of_flames, embrace_chaos, accelerando(3), potion_of_prolonged_power
0:41.515 default Q chaos_bolt Fluffy_Pillow 509957.5/1100000: 46% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando(3), potion_of_prolonged_power
0:42.894 default R incinerate Fluffy_Pillow 529308.7/1100000: 48% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos, accelerando(2), potion_of_prolonged_power
0:44.293 default P dimensional_rift Fluffy_Pillow 483179.8/1100000: 44% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos, accelerando(2), potion_of_prolonged_power
0:45.459 default R incinerate Fluffy_Pillow 499741.4/1100000: 45% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando(2), potion_of_prolonged_power
0:46.856 default K conflagrate Fluffy_Pillow 453584.9/1100000: 41% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando(3), potion_of_prolonged_power
0:48.003 default P dimensional_rift Fluffy_Pillow 470123.6/1100000: 43% mana | 2.0/5: 40% soul_shard lord_of_flames, accelerando(3), potion_of_prolonged_power
0:49.151 default Q chaos_bolt Fluffy_Pillow 486676.7/1100000: 44% mana | 2.0/5: 40% soul_shard lord_of_flames, accelerando(3), potion_of_prolonged_power
0:51.444 default R incinerate Fluffy_Pillow 519739.7/1100000: 47% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos, accelerando(3), potion_of_prolonged_power
0:52.822 default Q chaos_bolt Fluffy_Pillow 473609.2/1100000: 43% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando(3), potion_of_prolonged_power
0:54.200 default R incinerate Fluffy_Pillow 493478.7/1100000: 45% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando(3), potion_of_prolonged_power
0:55.578 default E immolate Fluffy_Pillow 446542.2/1100000: 41% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando, potion_of_prolonged_power
0:56.762 default R incinerate Fluffy_Pillow 397104.2/1100000: 36% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando, potion_of_prolonged_power
0:58.181 default Q chaos_bolt Fluffy_Pillow 350953.5/1100000: 32% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando
0:59.603 default Q chaos_bolt Fluffy_Pillow 370844.7/1100000: 34% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando
1:01.023 default C havoc enemy2 390709.0/1100000: 36% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando(2)
1:02.188 default R incinerate Fluffy_Pillow 319256.4/1100000: 29% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando(2)
1:03.586 default R incinerate Fluffy_Pillow 273113.3/1100000: 25% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando(2)
1:04.983 default G immolate Fluffy_Pillow 226956.0/1100000: 21% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando(2)
1:06.149 default J conflagrate Fluffy_Pillow 177517.6/1100000: 16% mana | 2.0/5: 40% soul_shard lord_of_flames, accelerando(2)
1:07.316 default Q chaos_bolt Fluffy_Pillow 194093.4/1100000: 18% mana | 4.0/5: 80% soul_shard lord_of_flames, accelerando(2)
1:09.643 default Q chaos_bolt Fluffy_Pillow 226253.6/1100000: 21% mana | 3.0/5: 60% soul_shard lord_of_flames, embrace_chaos
1:11.084 default K conflagrate Fluffy_Pillow 246100.4/1100000: 22% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos
1:12.286 default Q chaos_bolt Fluffy_Pillow 262655.4/1100000: 24% mana | 3.0/5: 60% soul_shard lord_of_flames, embrace_chaos
1:13.727 default K conflagrate Fluffy_Pillow 282533.7/1100000: 26% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando
1:14.911 default Q chaos_bolt Fluffy_Pillow 299095.7/1100000: 27% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
1:16.331 default K conflagrate Fluffy_Pillow 319043.5/1100000: 29% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
1:17.498 default Q chaos_bolt Fluffy_Pillow 335619.3/1100000: 31% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
1:18.895 default Q chaos_bolt Fluffy_Pillow 355462.0/1100000: 32% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
1:20.292 default R incinerate Fluffy_Pillow 375304.7/1100000: 34% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
1:21.688 default C havoc enemy2 329133.8/1100000: 30% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
1:22.838 default K conflagrate Fluffy_Pillow 257715.8/1100000: 23% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
1:23.986 default P dimensional_rift Fluffy_Pillow 274268.9/1100000: 25% mana | 3.0/5: 60% soul_shard lord_of_flames, embrace_chaos, accelerando(3)
1:25.135 default Q chaos_bolt Fluffy_Pillow 290836.4/1100000: 26% mana | 3.0/5: 60% soul_shard lord_of_flames, accelerando(3)
1:27.427 default E immolate Fluffy_Pillow 322691.4/1100000: 29% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos
1:28.631 default Q chaos_bolt Fluffy_Pillow 273274.0/1100000: 25% mana | 4.0/5: 80% soul_shard lord_of_flames, embrace_chaos
1:30.073 default Q chaos_bolt Fluffy_Pillow 293134.5/1100000: 27% mana | 3.0/5: 60% soul_shard lord_of_flames, embrace_chaos
1:31.512 default P dimensional_rift Fluffy_Pillow 312954.1/1100000: 28% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando
1:32.696 default Q chaos_bolt Fluffy_Pillow 329516.1/1100000: 30% mana | 3.0/5: 60% soul_shard lord_of_flames, embrace_chaos, accelerando
1:34.116 default R incinerate Fluffy_Pillow 349380.4/1100000: 32% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando(2)
1:35.514 default L service_imp Fluffy_Pillow 303238.4/1100000: 28% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando(3)
1:36.662 default P dimensional_rift Fluffy_Pillow 319791.5/1100000: 29% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando(3)
1:37.812 default R incinerate Fluffy_Pillow 336373.4/1100000: 31% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando(3)
1:39.191 default Q chaos_bolt Fluffy_Pillow 290257.4/1100000: 26% mana | 2.0/5: 40% soul_shard lord_of_flames, accelerando(3)
1:41.484 default G immolate Fluffy_Pillow 323382.0/1100000: 29% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando(4)
1:42.616 default C havoc enemy2 273948.5/1100000: 25% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando(4)
1:43.746 default J conflagrate Fluffy_Pillow 202282.3/1100000: 18% mana | 3.0/5: 60% soul_shard lord_of_flames, embrace_chaos
1:44.949 default Q chaos_bolt Fluffy_Pillow 218851.1/1100000: 20% mana | 4.0/5: 80% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
1:46.391 default Q chaos_bolt Fluffy_Pillow 238859.1/1100000: 22% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
1:47.810 default Q chaos_bolt Fluffy_Pillow 258708.3/1100000: 24% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
1:49.228 default K conflagrate Fluffy_Pillow 278543.5/1100000: 25% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
1:50.413 default F immolate enemy2 295119.5/1100000: 27% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando
1:51.596 default Q chaos_bolt Fluffy_Pillow 245667.6/1100000: 22% mana | 3.0/5: 60% soul_shard lord_of_flames, embrace_chaos, accelerando
1:53.016 default K conflagrate Fluffy_Pillow 265530.8/1100000: 24% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando
1:54.200 default Q chaos_bolt Fluffy_Pillow 282092.8/1100000: 26% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
1:55.620 default K conflagrate Fluffy_Pillow 301957.1/1100000: 27% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
1:56.785 default Q chaos_bolt Fluffy_Pillow 318504.5/1100000: 29% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
1:58.181 default K conflagrate Fluffy_Pillow 338164.5/1100000: 31% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
1:59.384 default Q chaos_bolt Fluffy_Pillow 354733.3/1100000: 32% mana | 3.0/5: 60% soul_shard lord_of_flames, embrace_chaos
2:00.826 default R incinerate Fluffy_Pillow 374802.6/1100000: 34% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando(2)
2:02.223 default R incinerate Fluffy_Pillow 328645.3/1100000: 30% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando(2)
2:03.619 default C havoc enemy2 282473.8/1100000: 26% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando(2)
2:04.784 default E immolate Fluffy_Pillow 211065.1/1100000: 19% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando(3)
2:05.933 default Q chaos_bolt Fluffy_Pillow 161632.7/1100000: 15% mana | 3.0/5: 60% soul_shard lord_of_flames, accelerando(3)
2:08.225 default O soul_harvest Fluffy_Pillow 194681.2/1100000: 18% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando(3)
2:08.225 default I potion Fluffy_Pillow 194681.2/1100000: 18% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, embrace_chaos, accelerando(3)
2:08.225 default R incinerate Fluffy_Pillow 194681.2/1100000: 18% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, embrace_chaos, accelerando(3), potion_of_deadly_grace
2:09.603 default R incinerate Fluffy_Pillow 148550.7/1100000: 14% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, embrace_chaos, accelerando(3), potion_of_deadly_grace
2:10.980 default Q chaos_bolt Fluffy_Pillow 102405.8/1100000: 9% mana | 2.0/5: 40% soul_shard soul_harvest, lord_of_flames, embrace_chaos, accelerando(3), potion_of_deadly_grace
2:12.357 default R incinerate Fluffy_Pillow 121940.4/1100000: 11% mana | 0.0/5: 0% soul_shard soul_harvest, lord_of_flames, embrace_chaos, potion_of_deadly_grace
2:13.800 default Q chaos_bolt Fluffy_Pillow 75814.7/1100000: 7% mana | 2.0/5: 40% soul_shard soul_harvest, lord_of_flames, embrace_chaos, potion_of_deadly_grace
2:15.243 default R incinerate Fluffy_Pillow 95688.9/1100000: 9% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, embrace_chaos, potion_of_deadly_grace
2:16.685 default P dimensional_rift Fluffy_Pillow 49550.5/1100000: 5% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, embrace_chaos, accelerando, potion_of_deadly_grace
2:17.868 default G immolate Fluffy_Pillow 66098.5/1100000: 6% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, embrace_chaos, accelerando, potion_of_deadly_grace
2:19.051 default J conflagrate Fluffy_Pillow 16646.5/1100000: 2% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, embrace_chaos, accelerando, potion_of_deadly_grace
2:20.234 default K conflagrate Fluffy_Pillow 33194.6/1100000: 3% mana | 2.0/5: 40% soul_shard soul_harvest, lord_of_flames, accelerando, potion_of_deadly_grace
2:21.416 default Q chaos_bolt Fluffy_Pillow 49728.6/1100000: 5% mana | 3.0/5: 60% soul_shard soul_harvest, lord_of_flames, accelerando, potion_of_deadly_grace
2:23.778 default K conflagrate Fluffy_Pillow 82768.7/1100000: 8% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, embrace_chaos, accelerando, potion_of_deadly_grace
2:24.960 default C havoc enemy2 99302.7/1100000: 9% mana | 2.0/5: 40% soul_shard soul_harvest, lord_of_flames, embrace_chaos, accelerando, potion_of_deadly_grace
2:26.142 default K conflagrate Fluffy_Pillow 27836.8/1100000: 3% mana | 2.0/5: 40% soul_shard soul_harvest, lord_of_flames, embrace_chaos, accelerando, potion_of_deadly_grace
2:27.326 default Q chaos_bolt Fluffy_Pillow 44654.1/1100000: 4% mana | 4.0/5: 80% soul_shard lord_of_flames, embrace_chaos, accelerando(2), potion_of_deadly_grace
2:28.723 default Q chaos_bolt Fluffy_Pillow 64478.2/1100000: 6% mana | 3.0/5: 60% soul_shard lord_of_flames, embrace_chaos, potion_of_deadly_grace
2:30.165 default R incinerate Fluffy_Pillow 84339.8/1100000: 8% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando, potion_of_deadly_grace
2:31.586 default S life_tap Fluffy_Pillow 38217.0/1100000: 3% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando, potion_of_deadly_grace
2:32.771 default R incinerate Fluffy_Pillow 384793.0/1100000: 35% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando, potion_of_deadly_grace
2:34.191 default K conflagrate Fluffy_Pillow 338730.8/1100000: 31% mana | 1.0/5: 20% soul_shard lord_of_flames, accelerando(2), potion_of_deadly_grace
2:35.356 default Q chaos_bolt Fluffy_Pillow 355278.2/1100000: 32% mana | 2.0/5: 40% soul_shard lord_of_flames, accelerando(2), potion_of_deadly_grace
2:37.684 default Q chaos_bolt Fluffy_Pillow 388664.4/1100000: 35% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando(4), potion_of_deadly_grace
2:39.040 default R incinerate Fluffy_Pillow 408509.0/1100000: 37% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos, accelerando(4)
2:40.396 default E immolate Fluffy_Pillow 362353.7/1100000: 33% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos, accelerando(4)
2:41.526 default R incinerate Fluffy_Pillow 312890.9/1100000: 28% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos, accelerando(4)
2:42.882 default R incinerate Fluffy_Pillow 266163.2/1100000: 24% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos
2:44.325 default R incinerate Fluffy_Pillow 220037.5/1100000: 20% mana | 0.0/5: 0% soul_shard lord_of_flames
2:45.767 default C havoc enemy2 173898.0/1100000: 16% mana | 0.0/5: 0% soul_shard lord_of_flames
2:46.969 default R incinerate Fluffy_Pillow 102453.0/1100000: 9% mana | 0.0/5: 0% soul_shard lord_of_flames
2:48.409 default S life_tap Fluffy_Pillow 56285.9/1100000: 5% mana | 1.0/5: 20% soul_shard lord_of_flames
2:49.610 default R incinerate Fluffy_Pillow 402964.1/1100000: 37% mana | 1.0/5: 20% soul_shard lord_of_flames, accelerando
2:51.030 default R incinerate Fluffy_Pillow 356828.4/1100000: 32% mana | 1.0/5: 20% soul_shard lord_of_flames, accelerando(2)
2:52.426 default G immolate Fluffy_Pillow 310656.9/1100000: 28% mana | 1.0/5: 20% soul_shard lord_of_flames, accelerando(2)
2:53.593 default J conflagrate Fluffy_Pillow 261232.7/1100000: 24% mana | 1.0/5: 20% soul_shard lord_of_flames, accelerando(2)
2:54.760 default K conflagrate Fluffy_Pillow 277808.5/1100000: 25% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, accelerando(2)
2:55.926 default Q chaos_bolt Fluffy_Pillow 294370.2/1100000: 27% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, accelerando(2)
2:58.254 default K conflagrate Fluffy_Pillow 327918.4/1100000: 30% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(3)
2:59.050 default Q chaos_bolt Fluffy_Pillow 339396.0/1100000: 31% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(3)
3:00.005 default R incinerate Fluffy_Pillow 353166.3/1100000: 32% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(3)
3:00.960 default K conflagrate Fluffy_Pillow 300936.5/1100000: 27% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(3)
3:01.757 default P dimensional_rift Fluffy_Pillow 311922.5/1100000: 28% mana | 3.0/5: 60% soul_shard lord_of_flames, embrace_chaos, nefarious_pact
3:02.590 default Q chaos_bolt Fluffy_Pillow 323395.3/1100000: 29% mana | 3.0/5: 60% soul_shard lord_of_flames, embrace_chaos, nefarious_pact
3:03.590 default R incinerate Fluffy_Pillow 337168.2/1100000: 31% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, nefarious_pact
3:04.592 default H berserking Fluffy_Pillow 284968.6/1100000: 26% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, nefarious_pact
3:04.592 default R incinerate Fluffy_Pillow 284968.6/1100000: 26% mana | 1.0/5: 20% soul_shard berserking, lord_of_flames, embrace_chaos, nefarious_pact
3:05.461 default L service_imp Fluffy_Pillow 232732.6/1100000: 21% mana | 1.0/5: 20% soul_shard berserking, lord_of_flames, embrace_chaos, nefarious_pact
3:06.269 default C havoc enemy2 245530.3/1100000: 22% mana | 0.0/5: 0% soul_shard berserking, lord_of_flames, embrace_chaos, nefarious_pact
3:07.023 default R incinerate Fluffy_Pillow 169472.8/1100000: 15% mana | 0.0/5: 0% soul_shard berserking, lord_of_flames, embrace_chaos, nefarious_pact
3:07.894 default K conflagrate Fluffy_Pillow 117340.9/1100000: 11% mana | 0.0/5: 0% soul_shard berserking, lord_of_flames, nefarious_pact, accelerando
3:08.651 default P dimensional_rift Fluffy_Pillow 129518.4/1100000: 12% mana | 1.0/5: 20% soul_shard berserking, lord_of_flames, devils_due, accelerando
3:09.862 default R incinerate Fluffy_Pillow 148999.0/1100000: 14% mana | 1.0/5: 20% soul_shard berserking, lord_of_flames, devils_due, accelerando
3:11.318 default R incinerate Fluffy_Pillow 106420.8/1100000: 10% mana | 1.0/5: 20% soul_shard berserking, lord_of_flames, devils_due, accelerando
3:12.771 default S life_tap Fluffy_Pillow 63795.1/1100000: 6% mana | 1.0/5: 20% soul_shard berserking, lord_of_flames, devils_due, accelerando(2)
3:13.965 default Q chaos_bolt Fluffy_Pillow 413319.9/1100000: 38% mana | 2.0/5: 40% soul_shard berserking, lord_of_flames, devils_due, accelerando(3)
3:16.314 default E immolate Fluffy_Pillow 448558.5/1100000: 41% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando(4)
3:17.446 default R incinerate Fluffy_Pillow 399125.0/1100000: 36% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando(4)
3:18.803 default R incinerate Fluffy_Pillow 352984.3/1100000: 32% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando(4)
3:20.160 default Q chaos_bolt Fluffy_Pillow 306461.9/1100000: 28% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando
3:21.579 default R incinerate Fluffy_Pillow 326312.0/1100000: 30% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos, accelerando(2)
3:22.976 default R incinerate Fluffy_Pillow 280154.7/1100000: 25% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos, accelerando(2)
3:24.372 default G immolate Fluffy_Pillow 233983.8/1100000: 21% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos, accelerando(3)
3:25.520 default J conflagrate Fluffy_Pillow 184537.0/1100000: 17% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos, accelerando(3)
3:26.666 default C havoc enemy2 201061.2/1100000: 18% mana | 2.0/5: 40% soul_shard lord_of_flames, accelerando(3)
3:27.813 default Q chaos_bolt Fluffy_Pillow 129600.0/1100000: 12% mana | 3.0/5: 60% soul_shard lord_of_flames, accelerando(3)
3:30.104 default K conflagrate Fluffy_Pillow 162882.2/1100000: 15% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando(4)
3:31.236 default K conflagrate Fluffy_Pillow 179448.7/1100000: 16% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando(4)
3:32.368 default Q chaos_bolt Fluffy_Pillow 195435.2/1100000: 18% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
3:33.809 default K conflagrate Fluffy_Pillow 215350.4/1100000: 20% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
3:34.975 default Q chaos_bolt Fluffy_Pillow 231912.0/1100000: 21% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
3:36.372 default R incinerate Fluffy_Pillow 251865.6/1100000: 23% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
3:37.749 default R incinerate Fluffy_Pillow 205720.7/1100000: 19% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
3:39.125 default R incinerate Fluffy_Pillow 159561.3/1100000: 15% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
3:40.503 default K conflagrate Fluffy_Pillow 113430.8/1100000: 10% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, accelerando(3)
3:41.651 default Q chaos_bolt Fluffy_Pillow 129984.0/1100000: 12% mana | 3.0/5: 60% soul_shard lord_of_flames, accelerando(3)
3:43.944 default R incinerate Fluffy_Pillow 163046.9/1100000: 15% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando(3)
3:45.322 default R incinerate Fluffy_Pillow 116916.5/1100000: 11% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando(3)
3:46.700 default E immolate Fluffy_Pillow 70007.3/1100000: 6% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos
3:47.902 default P dimensional_rift Fluffy_Pillow 20685.2/1100000: 2% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando
3:49.085 default S life_tap Fluffy_Pillow 37233.2/1100000: 3% mana | 1.0/5: 20% soul_shard lord_of_flames, accelerando
3:50.268 default C havoc enemy2 383781.3/1100000: 35% mana | 1.0/5: 20% soul_shard lord_of_flames, accelerando
3:51.453 default F immolate enemy2 312357.3/1100000: 28% mana | 2.0/5: 40% soul_shard lord_of_flames, accelerando
3:52.638 default Q chaos_bolt Fluffy_Pillow 262933.3/1100000: 24% mana | 2.0/5: 40% soul_shard lord_of_flames, accelerando
3:55.002 default N summon_doomguard Fluffy_Pillow 296001.3/1100000: 27% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando
3:56.184 default R incinerate Fluffy_Pillow 312576.6/1100000: 28% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos, accelerando(2)
3:57.582 default R incinerate Fluffy_Pillow 266483.4/1100000: 24% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando(3)
3:58.958 default G immolate Fluffy_Pillow 220454.7/1100000: 20% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando(4)
4:00.089 default J conflagrate Fluffy_Pillow 170353.3/1100000: 15% mana | 1.0/5: 20% soul_shard lord_of_flames
4:01.292 default K conflagrate Fluffy_Pillow 186922.1/1100000: 17% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos
4:02.494 default Q chaos_bolt Fluffy_Pillow 203477.1/1100000: 18% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos
4:04.896 default K conflagrate Fluffy_Pillow 236559.6/1100000: 22% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
4:06.097 default Q chaos_bolt Fluffy_Pillow 253100.8/1100000: 23% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
4:07.539 default R incinerate Fluffy_Pillow 273107.3/1100000: 25% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
4:08.959 default K conflagrate Fluffy_Pillow 226970.5/1100000: 21% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
4:10.144 default O soul_harvest Fluffy_Pillow 243546.5/1100000: 22% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
4:10.144 default Q chaos_bolt Fluffy_Pillow 243546.5/1100000: 22% mana | 2.0/5: 40% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
4:11.563 default C havoc enemy2 263395.7/1100000: 24% mana | 0.0/5: 0% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
4:12.749 default R incinerate Fluffy_Pillow 191985.7/1100000: 17% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
4:14.169 default R incinerate Fluffy_Pillow 145848.9/1100000: 13% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
4:15.588 default K conflagrate Fluffy_Pillow 99698.2/1100000: 9% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, accelerando
4:16.772 default Q chaos_bolt Fluffy_Pillow 116260.2/1100000: 11% mana | 2.0/5: 40% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, accelerando
4:19.134 default R incinerate Fluffy_Pillow 149585.8/1100000: 14% mana | 0.0/5: 0% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos
4:20.575 default R incinerate Fluffy_Pillow 103433.4/1100000: 9% mana | 0.0/5: 0% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
4:21.995 default S life_tap Fluffy_Pillow 57296.6/1100000: 5% mana | 0.0/5: 0% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
4:23.180 default E immolate Fluffy_Pillow 403872.6/1100000: 37% mana | 0.0/5: 0% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, accelerando
4:24.364 default R incinerate Fluffy_Pillow 354647.9/1100000: 32% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, nefarious_pact, accelerando(2)
4:25.334 default R incinerate Fluffy_Pillow 302426.6/1100000: 27% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, nefarious_pact, accelerando(3)
4:26.288 default R incinerate Fluffy_Pillow 250182.4/1100000: 23% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, nefarious_pact, accelerando(3)
4:27.244 default R incinerate Fluffy_Pillow 197967.1/1100000: 18% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, nefarious_pact, accelerando(3)
4:28.200 default R incinerate Fluffy_Pillow 145751.7/1100000: 13% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, nefarious_pact, accelerando(3)
4:29.155 default Q chaos_bolt Fluffy_Pillow 93522.0/1100000: 9% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, nefarious_pact, accelerando(3)
4:30.745 default R incinerate Fluffy_Pillow 116448.3/1100000: 11% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(3)
4:31.700 default P dimensional_rift Fluffy_Pillow 64218.6/1100000: 6% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(3)
4:32.499 default Q chaos_bolt Fluffy_Pillow 75739.4/1100000: 7% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(3)
4:33.456 default C havoc enemy2 88967.9/1100000: 8% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando
4:34.277 default S life_tap Fluffy_Pillow 12452.2/1100000: 1% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando
4:35.098 default G immolate Fluffy_Pillow 353936.5/1100000: 32% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando
4:35.919 default J conflagrate Fluffy_Pillow 299420.8/1100000: 27% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, devils_due, accelerando
4:37.312 default J conflagrate Fluffy_Pillow 318906.3/1100000: 29% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due, accelerando
4:38.705 default J conflagrate Fluffy_Pillow 338391.9/1100000: 31% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, devils_due, accelerando
4:40.100 default L service_imp Fluffy_Pillow 357905.4/1100000: 33% mana | 4.0/5: 80% soul_shard lord_of_flames, conflagration_of_chaos, devils_due, accelerando
4:41.494 default Q chaos_bolt Fluffy_Pillow 377493.1/1100000: 34% mana | 4.0/5: 80% soul_shard lord_of_flames, conflagration_of_chaos, devils_due, accelerando(2)
4:44.235 default J conflagrate Fluffy_Pillow 416514.6/1100000: 38% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
4:45.384 default Q chaos_bolt Fluffy_Pillow 433082.1/1100000: 39% mana | 4.0/5: 80% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
4:46.761 default Q chaos_bolt Fluffy_Pillow 452090.0/1100000: 41% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
4:48.204 default R incinerate Fluffy_Pillow 471964.3/1100000: 43% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
4:49.645 default R incinerate Fluffy_Pillow 425811.0/1100000: 39% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
4:51.087 default J conflagrate Fluffy_Pillow 379671.5/1100000: 35% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
4:52.290 default Q chaos_bolt Fluffy_Pillow 396240.3/1100000: 36% mana | 2.0/5: 40% soul_shard lord_of_flames
4:54.690 default C havoc enemy2 429588.2/1100000: 39% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando(2)
4:55.855 default R incinerate Fluffy_Pillow 358135.7/1100000: 33% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando(2)
4:57.251 default E immolate Fluffy_Pillow 311964.1/1100000: 28% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando(2)
4:58.417 default J conflagrate Fluffy_Pillow 262525.8/1100000: 24% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando(2)
4:59.585 default P dimensional_rift Fluffy_Pillow 279115.8/1100000: 25% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, accelerando(2)
5:00.752 default Q chaos_bolt Fluffy_Pillow 295691.6/1100000: 27% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, accelerando(2)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4201 3876 0
Agility 7254 6929 0
Stamina 53625 53625 34991
Intellect 50912 49205 39539 (1278)
Spirit 1 1 0
Health 3217500 3217500 0
Mana 1100000 1100000 0
Soul Shard 5 5 0
Spell Power 50912 49205 0
Crit 15.92% 15.92% 4367
Haste 25.21% 24.21% 9078
Damage / Heal Versatility 5.96% 5.96% 2829
ManaReg per Second 13773 13663 0
Mastery 76.44% 76.44% 6991
Armor 2002 2002 2002
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 907.00
Local Head Eyes of Azj'Aqir
ilevel: 900, stats: { 253 Armor, +3255 Sta, +2170 Int, +1074 Haste, +578 Vers }
Local Neck Radiant String of Scorpid Eyes
ilevel: 900, stats: { +1831 Sta, +2011 Haste, +922 Crit }, enchant: mark_of_the_hidden_satyr
Local Shoulders Pauldrons of Azj'Aqir
ilevel: 900, stats: { 233 Armor, +2442 Sta, +1628 Int, +752 Mastery, +487 Vers }
Local Chest Finery of Azj'Aqir
ilevel: 905, stats: { 317 Armor, +3410 Sta, +2273 Int, +1058 Mastery, +625 Crit }
Local Waist Man'ari Skullbuckled Cinch
ilevel: 900, stats: { 175 Armor, +2442 Sta, +1628 Int, +699 Haste, +540 Mastery }
Local Legs Pillars of the Dark Portal
ilevel: 940, stats: { 314 Armor, +4726 Sta, +3150 Int, +1097 Crit, +822 Mastery }
Local Feet Outcast Wanderer's Footrags
ilevel: 910, stats: { 222 Armor, +2680 Sta, +1786 Int, +864 Crit, +422 Mastery }
Local Wrists Woven Lasher Tendril Bracers
ilevel: 900, stats: { 136 Armor, +1831 Sta, +1221 Int, +644 Haste, +285 Vers }
Local Hands Clutch of Azj'Aqir
ilevel: 900, stats: { 194 Armor, +2442 Sta, +1628 Int, +859 Crit, +380 Mastery }
Local Finger1 Ring of the Scoured Clan
ilevel: 900, stats: { +1831 Sta, +2095 Mastery, +838 Haste }, enchant: { +200 Haste }
Local Finger2 Ring of Braided Stems
ilevel: 905, stats: { +1918 Sta, +1814 Haste, +1209 Vers }, enchant: { +200 Haste }
Local Trinket1 Whispers in the Dark
ilevel: 905, stats: { +2162 Int }
Local Trinket2 Erratic Metronome
ilevel: 900, stats: { +2063 Int }
Local Back Astromancer's Greatcloak
ilevel: 905, stats: { 158 Armor, +1918 Sta, +1278 StrAgiInt, +676 Haste, +270 Vers }, enchant: { +200 Int }
Local Main Hand Scepter of Sargeras
ilevel: 929, weapon: { 7005 - 10509, 3.6 }, stats: { +2843 Int, +4265 Sta, +922 Haste, +922 Mastery, +15509 Int }, relics: { +61 ilevels, +59 ilevels, +61 ilevels }

Talents

Level
15 Backdraft (Destruction Warlock) Roaring Blaze (Destruction Warlock) Shadowburn (Destruction Warlock)
30 Reverse Entropy (Destruction Warlock) Eradication (Destruction Warlock) Empowered Life Tap
45 Demonic Circle Mortal Coil Shadowfury
60 Cataclysm (Destruction Warlock) Fire and Brimstone (Destruction Warlock) Soul Harvest
75 Demon Skin Burning Rush Dark Pact
90 Grimoire of Supremacy Grimoire of Service Grimoire of Sacrifice
100 Wreak Havoc (Destruction Warlock) Channel Demonfire (Destruction Warlock) Soul Conduit

Profile

warlock="Portal_Pants"
level=110
race=troll
role=spell
position=back
talents=2203021
artifact=38:142513:142516:142513:0:803:1:804:3:805:3:806:5:807:3:808:3:809:4:810:3:811:3:812:3:813:1:814:1:815:1:816:1:817:1:818:1:1355:1
spec=destruction

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,type=whispered_pact
actions.precombat+=/food,type=azshari_salad
actions.precombat+=/summon_pet,if=!talent.grimoire_of_supremacy.enabled&(!talent.grimoire_of_sacrifice.enabled|buff.demonic_power.down)
actions.precombat+=/summon_infernal,if=talent.grimoire_of_supremacy.enabled&artifact.lord_of_flames.rank>0
actions.precombat+=/summon_infernal,if=talent.grimoire_of_supremacy.enabled&active_enemies>1
actions.precombat+=/summon_doomguard,if=talent.grimoire_of_supremacy.enabled&active_enemies=1&artifact.lord_of_flames.rank=0
actions.precombat+=/augmentation,type=defiled
actions.precombat+=/snapshot_stats
actions.precombat+=/grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
actions.precombat+=/life_tap,if=talent.empowered_life_tap.enabled&!buff.empowered_life_tap.remains
actions.precombat+=/potion,name=prolonged_power
actions.precombat+=/chaos_bolt

# Executed every time the actor is available.
actions=havoc,target=2,if=active_enemies>1&(active_enemies<4|talent.wreak_havoc.enabled&active_enemies<6)&!debuff.havoc.remains
actions+=/dimensional_rift,if=charges=3
actions+=/immolate,if=remains<=tick_time
actions+=/immolate,cycle_targets=1,if=active_enemies>1&remains<=tick_time&(!talent.roaring_blaze.enabled|(!debuff.roaring_blaze.remains&action.conflagrate.charges<2))
actions+=/immolate,if=talent.roaring_blaze.enabled&remains<=duration&!debuff.roaring_blaze.remains&target.time_to_die>10&(action.conflagrate.charges=2+set_bonus.tier19_4pc|(action.conflagrate.charges>=1+set_bonus.tier19_4pc&action.conflagrate.recharge_time<cast_time+gcd)|target.time_to_die<24)
actions+=/berserking
actions+=/blood_fury
actions+=/arcane_torrent
actions+=/potion,name=deadly_grace,if=(buff.soul_harvest.remains|trinket.proc.any.react|target.time_to_die<=45)
actions+=/shadowburn,if=buff.conflagration_of_chaos.remains<=action.chaos_bolt.cast_time
actions+=/shadowburn,if=(charges=1&recharge_time<action.chaos_bolt.cast_time|charges=2)&soul_shard<5
actions+=/conflagrate,if=talent.roaring_blaze.enabled&(charges=2+set_bonus.tier19_4pc|(charges>=1+set_bonus.tier19_4pc&recharge_time<gcd)|target.time_to_die<24)
actions+=/conflagrate,if=talent.roaring_blaze.enabled&debuff.roaring_blaze.stack>0&dot.immolate.remains>dot.immolate.duration*0.3&(active_enemies=1|soul_shard<3)&soul_shard<5
actions+=/conflagrate,if=!talent.roaring_blaze.enabled&!buff.backdraft.remains&buff.conflagration_of_chaos.remains<=action.chaos_bolt.cast_time
actions+=/conflagrate,if=!talent.roaring_blaze.enabled&!buff.backdraft.remains&(charges=1&recharge_time<action.chaos_bolt.cast_time|charges=2)&soul_shard<5
actions+=/life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<=gcd
actions+=/dimensional_rift,if=equipped.144369&!buff.lessons_of_spacetime.remains&((!talent.grimoire_of_supremacy.enabled&!cooldown.summon_doomguard.remains)|(talent.grimoire_of_service.enabled&!cooldown.service_pet.remains)|(talent.soul_harvest.enabled&!cooldown.soul_harvest.remains))
actions+=/service_pet
actions+=/summon_infernal,if=artifact.lord_of_flames.rank>0&!buff.lord_of_flames.remains
actions+=/summon_doomguard,if=!talent.grimoire_of_supremacy.enabled&spell_targets.infernal_awakening<=2&(target.time_to_die>180|target.health.pct<=20|target.time_to_die<30)
actions+=/summon_infernal,if=!talent.grimoire_of_supremacy.enabled&spell_targets.infernal_awakening>2
actions+=/summon_doomguard,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal=1&artifact.lord_of_flames.rank>0&buff.lord_of_flames.remains&!pet.doomguard.active
actions+=/summon_doomguard,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal=1&equipped.132379&!cooldown.sindorei_spite_icd.remains
actions+=/summon_infernal,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal>1&equipped.132379&!cooldown.sindorei_spite_icd.remains
actions+=/soul_harvest
actions+=/channel_demonfire,if=dot.immolate.remains>cast_time
actions+=/havoc,if=active_enemies=1&talent.wreak_havoc.enabled&equipped.132375&!debuff.havoc.remains
actions+=/rain_of_fire,if=active_enemies>=3&cooldown.havoc.remains<=12&!talent.wreak_havoc.enabled
actions+=/rain_of_fire,if=active_enemies>=6&talent.wreak_havoc.enabled
actions+=/dimensional_rift,if=!equipped.144369|charges>1|((!talent.grimoire_of_service.enabled|recharge_time<cooldown.service_pet.remains)&(!talent.soul_harvest.enabled|recharge_time<cooldown.soul_harvest.remains)&(!talent.grimoire_of_supremacy.enabled|recharge_time<cooldown.summon_doomguard.remains))
actions+=/life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<duration*0.3
actions+=/cataclysm
actions+=/chaos_bolt,if=(cooldown.havoc.remains>12&cooldown.havoc.remains|active_enemies<3|talent.wreak_havoc.enabled&active_enemies<6)
actions+=/shadowburn
actions+=/conflagrate,if=!talent.roaring_blaze.enabled&!buff.backdraft.remains
actions+=/immolate,if=!talent.roaring_blaze.enabled&remains<=duration*0.3
actions+=/incinerate
actions+=/life_tap

head=eyes_of_azjaqir,id=138314,bonus_id=3445
neck=radiant_string_of_scorpid_eyes,id=140898,bonus_id=3445,enchant_id=5439
shoulders=pauldrons_of_azjaqir,id=138323,bonus_id=3445
back=astromancers_greatcloak,id=140909,bonus_id=3518,enchant_id=5436
chest=finery_of_azjaqir,id=138320,bonus_id=3518
wrists=woven_lasher_tendril_bracers,id=140886,bonus_id=3445
hands=clutch_of_azjaqir,id=138311,bonus_id=3445
waist=manari_skullbuckled_cinch,id=140887,bonus_id=3445
legs=pillars_of_the_dark_portal,id=132357,ilevel=940
feet=outcast_wanderers_footrags,id=140914,bonus_id=3519
finger1=ring_of_the_scoured_clan,id=140897,bonus_id=3445,enchant=binding_of_haste
finger2=ring_of_braided_stems,id=140896,bonus_id=3518,enchant=binding_of_haste
trinket1=whispers_in_the_dark,id=140809,ilevel=905
trinket2=erratic_metronome,id=140792,ilevel=900
main_hand=scepter_of_sargeras,id=128941,ilevel=929,gem_id=140826/140837/140826,relic_id=3519/3518:3518/3519

# Gear Summary
# gear_ilvl=906.60
# gear_stamina=34991
# gear_intellect=39539
# gear_crit_rating=4367
# gear_haste_rating=9078
# gear_mastery_rating=6991
# gear_versatility_rating=2829
# gear_armor=2002
# set_bonus=tier19_2pc=1
# set_bonus=tier19_4pc=1
default_pet=imp

Prydaz : 1004030 dps, 586693 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
1004030.3 1004030.3 0.0 / 0.000% 0.0 / 0.0% 31.7
RPS Out RPS In Primary Resource Waiting APM Active Skill
26135.1 26135.1 Mana 0.00% 50.4 100.0% 100%
Talents
  • 15: Roaring Blaze (Destruction Warlock)
  • 30: Eradication (Destruction Warlock)
  • 60: Soul Harvest
  • 90: Grimoire of Service
  • 100: Wreak Havoc (Destruction Warlock)
  • Talent Calculator
Artifact

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Prydaz 1004030
Chaos Bolt 326705 32.6% 57.3 5.11sec 1715436 1122766 Direct 109.2 0 900039 900039 100.0%  

Stats details: chaos_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 57.28 109.18 0.00 0.00 1.5279 0.0000 98266744.12 98266744.12 0.00 1122766.21 1122766.21
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 109.18 100.00% 900038.90 566005 1420170 900266.26 841556 970669 98266744 98266744 0.00
 
 

Action details: chaos_bolt

Static Values
  • id:116858
  • school:chromatic
  • resource:soul_shard
  • range:40.0
  • travel_speed:16.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:2.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:116858
  • name:Chaos Bolt
  • school:chromatic
  • tooltip:
  • description:Unleashes a devastating blast of chaos, causing {$s1=1} Chaos damage. Chaos Bolt always critically strikes and your critical strike chance increases its damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:4.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Conflagrate 109726 10.9% 48.1 6.24sec 685069 655720 Direct 95.7 202932 460479 344387 54.9%  

Stats details: conflagrate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 48.12 95.71 0.00 0.00 1.0448 0.0000 32962382.40 32962382.40 0.00 655719.87 655719.87
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 43.14 45.08% 202932.40 129234 324260 203039.81 179241 231346 8755273 8755273 0.00
crit 52.57 54.92% 460479.14 258466 748238 460614.11 408395 514567 24207109 24207109 0.00
 
 

Action details: conflagrate

Static Values
  • id:17962
  • school:fire
  • resource:chi
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:9.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.roaring_blaze.enabled&(charges=2+set_bonus.tier19_4pc|(charges>=1+set_bonus.tier19_4pc&recharge_time<gcd)|target.time_to_die<24)
Spelldata
  • id:17962
  • name:Conflagrate
  • school:fire
  • tooltip:
  • description:Triggers an explosion on the target, dealing {$s1=1} Fire damage.{$?s196406=false}[ Reduces the cast time of Incinerate and Chaos Bolt by {$117828s1=30}% for {$117828d=10 seconds}.][] |cFFFFFFFFGenerates 1 Soul Shard.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.265510
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Deadly Grace 5241 0.5% 14.2 2.09sec 109066 0 Direct 14.2 94582 189227 109068 15.3%  

Stats details: deadly_grace

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.19 14.19 0.00 0.00 0.0000 0.0000 1547100.01 1547100.01 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 12.01 84.70% 94582.34 83888 100666 94598.98 88083 100666 1136345 1136345 0.00
crit 2.17 15.30% 189227.09 167777 201332 169867.75 0 201332 410755 410755 0.00
 
 

Action details: deadly_grace

Static Values
  • id:188091
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:25.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188091
  • name:Deadly Grace
  • school:arcane
  • tooltip:
  • description:Deal {$s1=63339 to 95008} Arcane damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:63338.72
  • base_dd_max:95008.08
 
Immolate 242093 24.1% 19.8 15.35sec 3665525 3464643 Direct 38.4 139835 279713 205947 47.3%  
Periodic 291.7 150661 301374 222189 47.5% 195.9%

Stats details: immolate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 19.84 38.45 291.66 291.66 1.0580 2.0226 72722855.52 72722855.52 0.00 119039.04 3464642.95
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 20.28 52.74% 139835.28 89662 224712 139829.23 119003 162420 2835528 2835528 0.00
crit 18.17 47.26% 279712.94 179321 449905 279731.78 231977 329224 5082902 5082902 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 153.2 52.54% 150661.06 36 446959 150907.68 128441 175202 23087900 23087900 0.00
crit 138.4 47.46% 301373.61 89 893928 301865.40 250402 351567 41716525 41716525 0.00
 
 

Action details: immolate

Static Values
  • id:348
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:66000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.32
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:remains<=tick_time
Spelldata
  • id:348
  • name:Immolate
  • school:fire
  • tooltip:
  • description:Burns the enemy, causing {$s1=1} Fire damage immediately and an additional $157736o1 Fire damage over {$157736d=18 seconds}. |cFFFFFFFFPeriodic damage has a {$193541s1=15}% chance to generate 1 Soul Shard. Chance doubled on critical strikes.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.332000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.721500
  • base_td:0.00
  • dot_duration:18.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Incinerate 136242 13.6% 79.5 3.60sec 515455 415842 Direct 152.5 232956 465968 268863 15.4%  

Stats details: incinerate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 79.55 152.51 0.00 0.00 1.2395 0.0000 41004131.20 41004131.20 0.00 415842.31 415842.31
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 129.01 84.59% 232955.99 144938 363661 233027.11 217078 249788 30052717 30052717 0.00
crit 23.50 15.41% 465968.15 289870 727305 466100.33 393481 549875 10951414 10951414 0.00
 
 

Action details: incinerate

Static Values
  • id:29722
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:66000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:29722
  • name:Incinerate
  • school:fire
  • tooltip:
  • description:Draws fire toward the enemy, dealing {$s2=0} Fire damage.{$?s29722=true}|!c3[][ Replaces Shadow Bolt.]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.331000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Mark of the Hidden Satyr 8786 0.9% 19.9 15.07sec 132758 0 Direct 19.9 115117 230419 132759 15.3%  

Stats details: mark_of_the_hidden_satyr

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 19.89 19.89 0.00 0.00 0.0000 0.0000 2640151.89 2640151.89 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 16.84 84.70% 115116.57 109698 138580 115147.81 109698 125624 1939030 1939030 0.00
crit 3.04 15.30% 230419.46 219396 277160 219916.22 0 277160 701122 701122 0.00
 
 

Action details: mark_of_the_hidden_satyr

Static Values
  • id:191259
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191259
  • name:Mark of the Hidden Satyr
  • school:fire
  • tooltip:
  • description:Deals fire damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:2.500000
  • spell_power_mod.direct:2.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
pet - imp 41732 / 41732
Firebolt 41732 4.2% 108.1 2.78sec 116013 94708 Direct 107.3 101325 202629 116913 15.4%  

Stats details: firebolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 108.13 107.30 0.00 0.00 1.2250 0.0000 12544603.42 12544603.42 0.00 94708.42 94708.42
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 90.79 84.61% 101324.51 64723 122646 101353.35 99208 103481 9198900 9198900 0.00
crit 16.51 15.39% 202629.08 129446 245291 202689.18 174871 221778 3345703 3345703 0.00
 
 

Action details: firebolt

Static Values
  • id:3110
  • school:fire
  • resource:energy
  • range:40.0
  • travel_speed:16.0000
  • trigger_gcd:0.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.75
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:3110
  • name:Firebolt
  • school:fire
  • tooltip:
  • description:Deals {$s1=1} Fire damage to a target.$?a231795[ Damage increased by {$231795s1=50}% if you have Immolated the target.][] |cFF777777(Right-Click to toggle)|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
pet - service_imp 120897 / 38573
Firebolt 120897 3.8% 48.8 5.57sec 237047 206325 Direct 48.5 206670 413353 238387 15.3%  

Stats details: firebolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 48.76 48.48 0.00 0.00 1.1489 0.0000 11558131.90 11558131.90 0.00 206325.21 206325.21
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 41.04 84.65% 206670.31 129446 245291 206874.05 198311 215243 8482438 8482438 0.00
crit 7.44 15.35% 413352.88 258893 490583 413496.82 0 490583 3075693 3075693 0.00
 
 

Action details: firebolt

Static Values
  • id:3110
  • school:fire
  • resource:energy
  • range:40.0
  • travel_speed:16.0000
  • trigger_gcd:0.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.75
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:3110
  • name:Firebolt
  • school:fire
  • tooltip:
  • description:Deals {$s1=1} Fire damage to a target.$?a231795[ Damage increased by {$231795s1=50}% if you have Immolated the target.][] |cFF777777(Right-Click to toggle)|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
pet - infernal 114665 / 9710
Immolation 89269 0.7% 1.0 0.00sec 2231826 0 Periodic 46.4 41749 83466 48146 15.3% 8.1%

Stats details: immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 23.18 46.36 0.0000 1.0544 2231826.02 2231826.02 0.00 91322.31 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 39.2 84.67% 41749.36 36089 43306 41750.93 40715 42765 1638558 1638558 0.00
crit 7.1 15.33% 83466.15 72177 86613 83411.07 0 86613 593268 593268 0.00
 
 

Action details: immolation

Static Values
  • id:19483
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!ticking
Spelldata
  • id:19483
  • name:Immolation
  • school:fire
  • tooltip:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
 

Action details: immolation_tick

Static Values
  • id:20153
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all enemies near the caster.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
melee 25395 0.2% 22.0 1.11sec 28856 26013 Direct 22.0 24980 50011 28856 15.5%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.00 22.00 0.00 0.00 1.1093 0.0000 634902.51 933366.82 31.98 26013.13 26013.13
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 18.60 84.51% 24980.47 21581 25897 24980.26 24099 25897 464513 682879 31.98
crit 3.41 15.49% 50010.54 43162 51795 48783.43 0 51795 170389 250488 31.19
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
pet - doomguard 93108 / 7876
Doom Bolt 93108 0.8% 10.8 2.21sec 216085 99638 Direct 10.8 187089 374239 216100 15.5%  

Stats details: doom_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.77 10.77 0.00 0.00 2.1688 0.0000 2327746.54 2327746.54 0.00 99638.15 99638.15
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 9.10 84.50% 187089.26 181003 217204 187127.89 181003 217204 1702839 1702839 0.00
crit 1.67 15.50% 374238.86 362007 434408 314129.29 0 434408 624907 624907 0.00
 
 

Action details: doom_bolt

Static Values
  • id:85692
  • school:shadow
  • resource:energy
  • range:30.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:35.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:85692
  • name:Doom Bolt
  • school:shadow
  • tooltip:
  • description:Sends a shadowy bolt at the enemy, causing {$s1=1} Shadow damage. Deals {$s2=20}% additional damage to targets below 20% health.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
pet - lord_of_flames_infernal 114733 / 9717
Immolation 89358 0.7% 1.0 0.00sec 2234032 0 Periodic 46.4 41750 83460 48194 15.4% 8.1%

Stats details: immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 23.18 46.36 0.0000 1.0544 2234031.97 2234031.97 0.00 91412.58 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 39.2 84.55% 41749.91 36089 43306 41751.78 40682 42803 1636352 1636352 0.00
crit 7.2 15.45% 83460.38 72177 86613 83450.68 0 86613 597680 597680 0.00
 
 

Action details: immolation

Static Values
  • id:19483
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!ticking
Spelldata
  • id:19483
  • name:Immolation
  • school:fire
  • tooltip:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
 

Action details: immolation_tick

Static Values
  • id:20153
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all enemies near the caster.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
melee 25376 0.2% 22.0 1.11sec 28834 25993 Direct 22.0 24983 49983 28835 15.4%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.00 22.00 0.00 0.00 1.1093 0.0000 634417.75 932654.18 31.98 25993.27 25993.27
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 18.61 84.59% 24982.99 21581 25897 24983.16 24237 25897 464998 683591 31.98
crit 3.39 15.41% 49983.18 43162 51795 48711.95 0 51795 169420 249063 31.15
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
pet - lord_of_flames_infernal 114761 / 9718
Immolation 89417 0.7% 1.0 0.00sec 2235507 0 Periodic 46.4 41746 83499 48224 15.5% 8.1%

Stats details: immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 23.18 46.36 0.0000 1.0544 2235506.69 2235506.69 0.00 91472.92 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 39.2 84.48% 41746.38 36089 43306 41748.09 40666 42791 1634877 1634877 0.00
crit 7.2 15.52% 83499.00 72177 86613 83467.22 0 86613 600630 600630 0.00
 
 

Action details: immolation

Static Values
  • id:19483
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!ticking
Spelldata
  • id:19483
  • name:Immolation
  • school:fire
  • tooltip:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
 

Action details: immolation_tick

Static Values
  • id:20153
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all enemies near the caster.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
melee 25344 0.2% 22.0 1.11sec 28799 25961 Direct 22.0 24984 49968 28799 15.3%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.00 22.00 0.00 0.00 1.1093 0.0000 633631.69 931498.60 31.98 25961.06 25961.06
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 18.64 84.73% 24984.41 21581 25897 24984.52 24356 25897 465784 684747 31.98
crit 3.36 15.27% 49967.55 43162 51795 48589.93 0 51795 167847 246752 31.09
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
pet - lord_of_flames_infernal 114658 / 9710
Immolation 89306 0.7% 1.0 0.00sec 2232743 0 Periodic 46.4 41748 83480 48165 15.4% 8.1%

Stats details: immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 23.18 46.36 0.0000 1.0544 2232743.48 2232743.48 0.00 91359.85 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 39.2 84.62% 41748.13 36089 43306 41749.83 40530 42814 1637640 1637640 0.00
crit 7.1 15.38% 83479.76 72177 86613 83444.02 0 86613 595103 595103 0.00
 
 

Action details: immolation

Static Values
  • id:19483
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!ticking
Spelldata
  • id:19483
  • name:Immolation
  • school:fire
  • tooltip:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
 

Action details: immolation_tick

Static Values
  • id:20153
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all enemies near the caster.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
melee 25352 0.2% 22.0 1.11sec 28808 25969 Direct 22.0 24984 49969 28807 15.3%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.00 22.00 0.00 0.00 1.1093 0.0000 633826.80 931785.43 31.98 25969.06 25969.06
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 18.64 84.70% 24984.27 21581 25897 24984.47 24356 25897 465589 684460 31.98
crit 3.37 15.30% 49969.15 43162 51795 48627.95 0 51795 168238 247325 31.13
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
pet - shadowy_tear 119839 / 20445
Shadow Bolt 119839 2.0% 4.4 59.54sec 1388820 0 Periodic 48.3 109494 218954 126368 15.4% 19.9%

Stats details: shadow_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.40 0.00 48.59 48.32 0.0000 1.2328 6106137.09 6106137.09 0.00 101940.55 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 40.9 84.58% 109493.93 59 133251 109214.50 0 133251 4475079 4475079 0.00
crit 7.4 15.42% 218954.19 136 266503 216531.35 0 266503 1631058 1631058 0.00
 
 

Action details: shadow_bolt

Static Values
  • id:196657
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:196657
  • name:Shadow Bolt
  • school:shadow
  • tooltip:
  • description:Sends a shadowy bolt at the enemy, causing {$s1=1} Shadow damage.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:14.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
pet - chaos_tear 137239 / 9566
Chaos Bolt 137239 1.0% 4.4 59.32sec 651480 325755 Direct 4.4 0 655817 655817 100.0%  

Stats details: chaos_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.40 4.37 0.00 0.00 2.0000 0.0000 2867298.96 2867298.96 0.00 325755.39 325755.39
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 4.37 100.00% 655816.70 608484 768689 656393.20 0 768689 2867299 2867299 0.00
 
 

Action details: chaos_bolt

Static Values
  • id:215279
  • school:chromatic
  • resource:none
  • range:100.0
  • travel_speed:16.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:5.500
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:215279
  • name:Chaos Bolt
  • school:chromatic
  • tooltip:
  • description:Unleashes a devastating blast of chaos, causing {$s1=1} Chaos damage. Chaos Bolt always critically strikes and your critical strike chance increases its damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:5.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
pet - chaos_portal 245245 / 18511
Chaos Barrage 245245 1.8% 4.4 58.95sec 1256657 0 Periodic 153.5 31291 62592 36108 15.4% 8.0%

Stats details: chaos_barrage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.41 0.00 154.27 153.47 0.0000 0.1553 5541611.08 5541611.08 0.00 231353.53 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 129.9 84.61% 31290.53 129 36645 31229.96 0 36645 4063152 4063152 0.00
crit 23.6 15.39% 62591.67 263 73290 62434.68 0 73290 1478459 1478459 0.00
 
 

Action details: chaos_barrage

Static Values
  • id:187394
  • school:magic
  • resource:none
  • range:100.0
  • travel_speed:24.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:187394
  • name:Chaos Barrage
  • school:magic
  • tooltip:
  • description:Deals {$s1=1} Chaos damage.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:5.50
  • base_tick_time:0.25
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Simple Action Stats Execute Interval
Prydaz
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Prydaz
  • harmful:false
  • if_expr:
 
Berserking 2.1 180.54sec

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.08 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=15}%.
  • description:Increases your haste by {$s1=15}% for {$d=10 seconds}.
 
Dimensional Rift 13.1 23.24sec

Stats details: dimensional_rift

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.15 0.00 0.00 0.00 1.0169 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: dimensional_rift

Static Values
  • id:196586
  • school:none
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:45.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:charges=3
Spelldata
  • id:196586
  • name:Dimensional Rift
  • school:chaos
  • tooltip:
  • description:Rips a hole in time and space, opening a portal that damages your target.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Prydaz
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Prydaz
  • harmful:false
  • if_expr:
 
Havoc 14.9 20.92sec

Stats details: havoc

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.89 0.00 0.00 0.00 1.0738 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: havoc

Static Values
  • id:80240
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:88000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies>1&(active_enemies<4|talent.wreak_havoc.enabled&active_enemies<6)&!debuff.havoc.remains
Spelldata
  • id:80240
  • name:Havoc
  • school:shadow
  • tooltip:Spells cast by the Warlock also hit this target.
  • description:Marks a target with Havoc for {$d=8 seconds}, causing your single target spells to also strike the Havoc victim. Limit 1.
 
Life Tap 7.6 30.38sec

Stats details: life_tap

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.56 0.00 0.00 0.00 1.0550 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: life_tap

Static Values
  • id:1454
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.empowered_life_tap.enabled&!buff.empowered_life_tap.remains
Spelldata
  • id:1454
  • name:Life Tap
  • school:shadow
  • tooltip:
  • description:Restores {$s1=30}% of your maximum mana, at the cost of {$s2=10}% of your maximum health.
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Grimoire: Imp (service_imp) 3.7 91.82sec

Stats details: service_imp

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.68 0.00 0.00 0.00 0.9775 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: service_imp

Static Values
  • id:111859
  • school:shadow
  • resource:soul_shard
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:90.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:111859
  • name:Grimoire: Imp
  • school:shadow
  • tooltip:
  • description:Summons an Imp who attacks the target for {$108501s1=25} sec. Imps cast ranged Firebolts and cleanse a hostile magic effect from their master.
 
Soul Harvest 2.9 120.91sec

Stats details: soul_harvest

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.90 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: soul_harvest

Static Values
  • id:196098
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:196098
  • name:Soul Harvest
  • school:shadow
  • tooltip:Damage increased by {$s1=20}%.
  • description:Increases your damage and your pets' damage by {$s1=20}%. Lasts {$d=15 seconds}, increased by {$s2=2} sec for each target afflicted by your {$?s137043=false}[Agony][]{$?s137044=false}[Doom][]{$?s137046=false}[Immolate][], up to a maximum of {$s3=35} sec.
 
Summon Doomguard 1.0 0.00sec

Stats details: summon_doomguard

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 1.0903 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_doomguard

Static Values
  • id:18540
  • school:shadow
  • resource:soul_shard
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.grimoire_of_supremacy.enabled&active_enemies=1&artifact.lord_of_flames.rank=0
Spelldata
  • id:18540
  • name:Summon Doomguard
  • school:shadow
  • tooltip:
  • description:Summons a Doomguard for {$60478d=25 seconds} to assault the target with its Doom Bolts.
 
Summon Imp 1.0 0.00sec

Stats details: summon_imp

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_imp

Static Values
  • id:688
  • school:shadow
  • resource:soul_shard
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!talent.grimoire_of_supremacy.enabled&(!talent.grimoire_of_sacrifice.enabled|buff.demonic_power.down)
Spelldata
  • id:688
  • name:Summon Imp
  • school:shadow
  • tooltip:
  • description:Summons an Imp under your command that casts ranged Firebolts.$?s74434[ |cFFFFFFFFSoulburn:|r |cFF8282FFInstant cast.|r][]
 
Summon Infernal 1.0 0.00sec

Stats details: summon_infernal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.7601 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_infernal

Static Values
  • id:1122
  • school:shadow
  • resource:soul_shard
  • range:30.0
  • travel_speed:1.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.grimoire_of_supremacy.enabled&artifact.lord_of_flames.rank>0
Spelldata
  • id:1122
  • name:Summon Infernal
  • school:shadow
  • tooltip:
  • description:Summons an Infernal from the Twisting Nether, impacting for {$22703s1=0} Fire damage and stunning all enemy targets in the area for {$22703d=2 seconds}. The Infernal will serve you for {$111685d=25 seconds}, dealing strong area-of-effect damage.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Accelerando 20.1 0.0 15.4sec 15.4sec 78.46% 78.46% 1.4(1.4) 19.3

Buff details

  • buff initial source:Prydaz
  • cooldown name:buff_accelerando
  • max_stacks:5
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:734.41

Stack Uptimes

  • accelerando_1:29.74%
  • accelerando_2:24.67%
  • accelerando_3:14.66%
  • accelerando_4:6.51%
  • accelerando_5:2.88%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225719
  • name:Accelerando
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc225125=Your damaging spells have a chance to grant you {$225719s1=528} Haste for {$225719d=12 seconds}, stacking up to 5 times. Stacking does not refresh duration.}
  • max_stacks:5
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Berserking 2.1 0.0 180.5sec 180.5sec 6.87% 8.38% 0.0(0.0) 2.0

Buff details

  • buff initial source:Prydaz
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:10.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • berserking_1:6.87%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=15}%.
  • description:Increases your haste by {$s1=15}% for {$d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.55% 15.51% 0.0(0.0) 1.0

Buff details

  • buff initial source:Prydaz
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:13.55%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Conflagration of Chaos 24.1 0.0 12.4sec 12.4sec 49.16% 46.70% 0.0(0.0) 1.1

Buff details

  • buff initial source:Prydaz
  • cooldown name:buff_conflagration_of_chaos
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:50.00%
  • default_value:-0.00

Stack Uptimes

  • conflagration_of_chaos_1:49.16%

Trigger Attempt Success

  • trigger_pct:50.06%

Spelldata details

  • id:196546
  • name:Conflagration of Chaos
  • tooltip:Your {$?s17877=false}[Shadowburn][Conflagrate] will always critically strike. Critical strike chance will increase the critical strike damage of {$?s17877=false}[Shadowburn][Conflagrate].
  • description:{$@spelldesc219195={$?s17877=false}[Shadowburn][Conflagrate] has a chance to guarantee your next {$?s17877=false}[Shadowburn][Conflagrate] critically strikes, and to increase its damage by your critical strike chance.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Devil's Due 3.5 0.0 69.8sec 69.8sec 8.70% 10.22% 0.0(0.0) 3.2

Buff details

  • buff initial source:Prydaz
  • cooldown name:buff_devils_due
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.18

Stack Uptimes

  • devils_due_1:8.70%

Trigger Attempt Success

  • trigger_pct:99.94%

Spelldata details

  • id:225776
  • name:Devil's Due
  • tooltip:Cast speed slowed by {$s1=7}%.
  • description:{$@spelldesc225142=Your damaging spells have a chance to grant Nefarious Pact, increasing your casting speed by {$225774s1=17}% for {$225774d=12 seconds}. When Nefarious Pact expires, your casting speed is decreased by {$225776s1=7}% for {$225776d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Embrace Chaos 26.1 32.2 11.8sec 5.1sec 59.15% 66.68% 32.2(32.2) 25.5

Buff details

  • buff initial source:Prydaz
  • cooldown name:buff_embrace_chaos
  • max_stacks:1
  • duration:4.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • embrace_chaos_1:59.15%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:212019
  • name:Embrace Chaos
  • tooltip:Chaos Bolt has {$s1=40}% reduced cast time.
  • description:{$@spelldesc212018=Casting Chaos Bolt reduces the cast time of your next Chaos Bolt by {$212019s1=40}% for {$212019d=4 seconds}.}
  • max_stacks:0
  • duration:4.00
  • cooldown:0.00
  • default_chance:0.00%
Lord of Flames 1.0 0.0 0.0sec 0.0sec 97.86% 97.86% 0.0(0.0) 0.0

Buff details

  • buff initial source:Prydaz
  • cooldown name:buff_lord_of_flames
  • max_stacks:1
  • duration:600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • lord_of_flames_1:97.86%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:226802
  • name:Lord of Flames
  • tooltip:Recently activated Lord of Flames.
  • description:{$@spelldesc224103=Once every {$s2=10} minutes, {$?s152107=false}[your Infernal's Meteor Strike][Summon Infernal] will summon {$s3=3} additional Infernals to serve you for {$226804d=25 seconds}.}
  • max_stacks:0
  • duration:600.00
  • cooldown:0.00
  • default_chance:0.00%
Nefarious Pact 3.5 0.0 70.1sec 69.5sec 13.53% 14.99% 0.0(0.0) 3.3

Buff details

  • buff initial source:Prydaz
  • cooldown name:buff_nefarious_pact
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.44

Stack Uptimes

  • nefarious_pact_1:13.53%

Trigger Attempt Success

  • trigger_pct:99.94%

Spelldata details

  • id:225774
  • name:Nefarious Pact
  • tooltip:Cast speed increased by {$s1=17}%.
  • description:{$@spelldesc225142=Your damaging spells have a chance to grant Nefarious Pact, increasing your casting speed by {$225774s1=17}% for {$225774d=12 seconds}. When Nefarious Pact expires, your casting speed is decreased by {$225776s1=7}% for {$225776d=8 seconds}.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of Deadly Grace 1.0 0.0 0.0sec 0.0sec 10.16% 10.16% 0.0(0.0) 1.0

Buff details

  • buff initial source:Prydaz
  • cooldown name:buff_potion_of_deadly_grace
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_deadly_grace_1:10.16%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188027
  • name:Potion of Deadly Grace
  • tooltip:Your attacks have a chance to unleash a bolt of energy at your target.
  • description:Grants your attacks a chance to unleash a bolt of energy at your target. Staying away from enemies for the entire duration of the effect will extend the effect by an additional 5 seconds.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
Potion of Prolonged Power 1.0 0.0 0.0sec 0.0sec 19.64% 19.64% 0.0(0.0) 1.0

Buff details

  • buff initial source:Prydaz
  • cooldown name:buff_potion_of_prolonged_power
  • max_stacks:1
  • duration:60.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:all
  • amount:2500.00

Stack Uptimes

  • potion_of_prolonged_power_1:19.64%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:229206
  • name:Potion of Prolonged Power
  • tooltip:All stats increased by {$s1=2500}.
  • description:Drink to increase all stats by {$s1=2500} for {$d=60 seconds}.
  • max_stacks:0
  • duration:60.00
  • cooldown:1.00
  • default_chance:0.00%
Soul Harvest 2.9 0.0 120.9sec 120.9sec 17.76% 17.76% 0.0(0.0) 2.7

Buff details

  • buff initial source:Prydaz
  • cooldown name:buff_soul_harvest
  • max_stacks:1
  • duration:15.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • soul_harvest_1:17.76%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:196098
  • name:Soul Harvest
  • tooltip:Damage increased by {$s1=20}%.
  • description:Increases your damage and your pets' damage by {$s1=20}%. Lasts {$d=15 seconds}, increased by {$s2=2} sec for each target afflicted by your {$?s137043=false}[Agony][]{$?s137044=false}[Doom][]{$?s137046=false}[Immolate][], up to a maximum of {$s3=35} sec.
  • max_stacks:0
  • duration:15.00
  • cooldown:120.00
  • default_chance:0.00%
Constant Buffs
Well Fed (azshari_salad)

Buff details

  • buff initial source:Prydaz
  • cooldown name:buff_azshari_salad
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:375.00

Stack Uptimes

  • azshari_salad_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225603
  • name:Well Fed
  • tooltip:Haste increased by $w1.
  • description:Increases haste by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Defiled Augmentation

Buff details

  • buff initial source:Prydaz
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Whispered Pact

Buff details

  • buff initial source:Prydaz
  • cooldown name:buff_flask_of_the_whispered_pact
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:1300.00

Stack Uptimes

  • flask_of_the_whispered_pact_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188031
  • name:Flask of the Whispered Pact
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%

Procs

Count Interval
shadowy_tear 4.4 58.8sec
chaos_tear 4.4 59.2sec
chaos_portal 4.4 59.0sec
dimension_ripper 4.0 54.2sec

Resources

Resource Usage Type Count Total Average RPE APR
Prydaz
chaos_bolt Soul Shard 58.3 116.6 2.0 2.0 843004.9
havoc Mana 14.9 1310164.6 88000.0 87999.7 0.0
immolate Mana 19.8 1309416.8 66000.0 65999.9 55.5
incinerate Mana 79.5 5250282.5 66000.0 66000.3 7.8
service_imp Soul Shard 3.7 3.7 1.0 1.0 0.0
summon_doomguard Soul Shard 1.0 1.0 1.0 1.0 0.0
summon_infernal Soul Shard 1.0 1.0 1.0 1.0 0.0
pet - imp
firebolt Energy 108.1 4325.2 40.0 40.0 2900.3
pet - service_imp
firebolt Energy 48.8 1950.4 40.0 40.0 5926.0
pet - doomguard
doom_bolt Energy 10.8 377.0 35.0 35.0 6173.9
Resource Gains Type Count Total Average Overflow
life_tap Mana 7.56 2495701.29 (35.61%) 330000.00 0.00 0.00%
immolate Soul Shard 64.64 64.11 (53.03%) 0.99 0.53 0.82%
conflagrate Soul Shard 48.12 48.07 (39.76%) 1.00 0.05 0.10%
mp5_regen Mana 473.69 4512127.87 (64.39%) 9525.43 87857.30 1.91%
soulsnatcher Soul Shard 8.72 8.72 (7.21%) 1.00 0.00 0.00%
pet - imp
energy_regen Energy 1899.91 4158.84 (100.00%) 2.19 21.58 0.52%
pet - service_imp
energy_regen Energy 439.81 1330.64 (100.00%) 3.03 61.65 4.43%
pet - doomguard
energy_regen Energy 15.59 335.77 (100.00%) 21.54 42.81 11.31%
Resource RPS-Gain RPS-Loss
Health 0.00 7926.54
Mana 23272.22 26135.07
Soul Shard 0.40 0.41
Combat End Resource Mean Min Max
Mana 235201.40 2334.80 525303.65
Soul Shard 1.65 0.00 5.00

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 1.4%

Statistics & Data Analysis

Fight Length
Sample Data Prydaz Fight Length
Count 9999
Mean 301.12
Minimum 221.26
Maximum 379.15
Spread ( max - min ) 157.89
Range [ ( max - min ) / 2 * 100% ] 26.22%
DPS
Sample Data Prydaz Damage Per Second
Count 9999
Mean 1004030.27
Minimum 890728.50
Maximum 1195619.74
Spread ( max - min ) 304891.24
Range [ ( max - min ) / 2 * 100% ] 15.18%
Priority Target DPS
Sample Data Prydaz Priority Target Damage Per Second
Count 9999
Mean 586692.64
Minimum 519761.30
Maximum 706119.36
Spread ( max - min ) 186358.06
Range [ ( max - min ) / 2 * 100% ] 15.88%
DPS(e)
Sample Data Prydaz Damage Per Second (Effective)
Count 9999
Mean 1004030.27
Minimum 890728.50
Maximum 1195619.74
Spread ( max - min ) 304891.24
Range [ ( max - min ) / 2 * 100% ] 15.18%
Damage
Sample Data Prydaz Damage
Count 9999
Mean 249143365.13
Minimum 179414601.82
Maximum 328276313.70
Spread ( max - min ) 148861711.88
Range [ ( max - min ) / 2 * 100% ] 29.87%
DTPS
Sample Data Prydaz Damage Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Prydaz Healing Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS(e)
Sample Data Prydaz Healing Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Prydaz Heal
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Prydaz Healing Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Prydaz Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
ETMI
Sample Data PrydazTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data Prydaz Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=whispered_pact
1 0.00 food,type=azshari_salad
2 0.00 summon_pet,if=!talent.grimoire_of_supremacy.enabled&(!talent.grimoire_of_sacrifice.enabled|buff.demonic_power.down)
3 0.00 summon_infernal,if=talent.grimoire_of_supremacy.enabled&artifact.lord_of_flames.rank>0
4 0.00 summon_infernal,if=talent.grimoire_of_supremacy.enabled&active_enemies>1
5 0.00 summon_doomguard,if=talent.grimoire_of_supremacy.enabled&active_enemies=1&artifact.lord_of_flames.rank=0
6 0.00 augmentation,type=defiled
7 0.00 snapshot_stats
8 0.00 grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
9 0.00 life_tap,if=talent.empowered_life_tap.enabled&!buff.empowered_life_tap.remains
A 0.00 potion,name=prolonged_power
B 0.00 chaos_bolt
Default action list Executed every time the actor is available.
# count action,conditions
C 14.89 havoc,target=2,if=active_enemies>1&(active_enemies<4|talent.wreak_havoc.enabled&active_enemies<6)&!debuff.havoc.remains
D 1.00 dimensional_rift,if=charges=3
E 10.29 immolate,if=remains<=tick_time
F 0.61 immolate,cycle_targets=1,if=active_enemies>1&remains<=tick_time&(!talent.roaring_blaze.enabled|(!debuff.roaring_blaze.remains&action.conflagrate.charges<2))
G 8.98 immolate,if=talent.roaring_blaze.enabled&remains<=duration&!debuff.roaring_blaze.remains&target.time_to_die>10&(action.conflagrate.charges=2+set_bonus.tier19_4pc|(action.conflagrate.charges>=1+set_bonus.tier19_4pc&action.conflagrate.recharge_time<cast_time+gcd)|target.time_to_die<24)
H 2.08 berserking
0.00 blood_fury
0.00 arcane_torrent
I 1.00 potion,name=deadly_grace,if=(buff.soul_harvest.remains|trinket.proc.any.react|target.time_to_die<=45)
0.00 shadowburn,if=buff.conflagration_of_chaos.remains<=action.chaos_bolt.cast_time
0.00 shadowburn,if=(charges=1&recharge_time<action.chaos_bolt.cast_time|charges=2)&soul_shard<5
J 13.81 conflagrate,if=talent.roaring_blaze.enabled&(charges=2+set_bonus.tier19_4pc|(charges>=1+set_bonus.tier19_4pc&recharge_time<gcd)|target.time_to_die<24)
K 34.31 conflagrate,if=talent.roaring_blaze.enabled&debuff.roaring_blaze.stack>0&dot.immolate.remains>dot.immolate.duration*0.3&(active_enemies=1|soul_shard<3)&soul_shard<5
0.00 conflagrate,if=!talent.roaring_blaze.enabled&!buff.backdraft.remains&buff.conflagration_of_chaos.remains<=action.chaos_bolt.cast_time
0.00 conflagrate,if=!talent.roaring_blaze.enabled&!buff.backdraft.remains&(charges=1&recharge_time<action.chaos_bolt.cast_time|charges=2)&soul_shard<5
0.00 life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<=gcd
0.00 dimensional_rift,if=equipped.144369&!buff.lessons_of_spacetime.remains&((!talent.grimoire_of_supremacy.enabled&!cooldown.summon_doomguard.remains)|(talent.grimoire_of_service.enabled&!cooldown.service_pet.remains)|(talent.soul_harvest.enabled&!cooldown.soul_harvest.remains))
L 3.68 service_pet
M 1.00 summon_infernal,if=artifact.lord_of_flames.rank>0&!buff.lord_of_flames.remains
N 1.00 summon_doomguard,if=!talent.grimoire_of_supremacy.enabled&spell_targets.infernal_awakening<=2&(target.time_to_die>180|target.health.pct<=20|target.time_to_die<30)
0.00 summon_infernal,if=!talent.grimoire_of_supremacy.enabled&spell_targets.infernal_awakening>2
0.00 summon_doomguard,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal=1&artifact.lord_of_flames.rank>0&buff.lord_of_flames.remains&!pet.doomguard.active
0.00 summon_doomguard,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal=1&equipped.132379&!cooldown.sindorei_spite_icd.remains
0.00 summon_infernal,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal>1&equipped.132379&!cooldown.sindorei_spite_icd.remains
O 2.90 soul_harvest
0.00 channel_demonfire,if=dot.immolate.remains>cast_time
0.00 havoc,if=active_enemies=1&talent.wreak_havoc.enabled&equipped.132375&!debuff.havoc.remains
0.00 rain_of_fire,if=active_enemies>=3&cooldown.havoc.remains<=12&!talent.wreak_havoc.enabled
0.00 rain_of_fire,if=active_enemies>=6&talent.wreak_havoc.enabled
P 12.15 dimensional_rift,if=!equipped.144369|charges>1|((!talent.grimoire_of_service.enabled|recharge_time<cooldown.service_pet.remains)&(!talent.soul_harvest.enabled|recharge_time<cooldown.soul_harvest.remains)&(!talent.grimoire_of_supremacy.enabled|recharge_time<cooldown.summon_doomguard.remains))
0.00 life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<duration*0.3
0.00 cataclysm
Q 57.59 chaos_bolt,if=(cooldown.havoc.remains>12&cooldown.havoc.remains|active_enemies<3|talent.wreak_havoc.enabled&active_enemies<6)
0.00 shadowburn
0.00 conflagrate,if=!talent.roaring_blaze.enabled&!buff.backdraft.remains
0.00 immolate,if=!talent.roaring_blaze.enabled&remains<=duration*0.3
R 79.89 incinerate
S 7.56 life_tap

Sample Sequence

0126ABCDEGHJKLKMOPPQQQKQKQRRRRQKQRCRRREQQQRGJKKQRRKQCRPKPRPRQRERRRPRCQGJKQQKQRRKQRRQRKQCSRRERPQRLRGJKQCKQKQRRRKQRSRERQCOIRRRSGJKKPQQKQQQCQKQQRREQRRRRRGQCJKKQQRRSKQRRRPKHQLRCEQRRRRRJKQQRSERCQGJKQKQRRKQRRRPRKQSCRNERQQRRRGJOQKCQKQKQRQKQRRRSEPCQQGJJLQJRRQRJRCRRJQEQ

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask Prydaz 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 1 food Prydaz 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 2 summon_imp Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 6 augmentation Prydaz 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat A potion Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard potion_of_prolonged_power
0:00.000 precombat B chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard embrace_chaos, accelerando, potion_of_prolonged_power
0:00.000 default C havoc enemy2 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard embrace_chaos, accelerando, potion_of_prolonged_power
0:01.152 default D dimensional_rift Fluffy_Pillow 1033541.3/1100000: 94% mana | 1.0/5: 20% soul_shard bloodlust, embrace_chaos, accelerando, potion_of_prolonged_power
0:02.040 default E immolate Fluffy_Pillow 1050395.0/1100000: 95% mana | 1.0/5: 20% soul_shard bloodlust, embrace_chaos, accelerando(2), potion_of_prolonged_power
0:02.916 default G immolate Fluffy_Pillow 1001020.9/1100000: 91% mana | 1.0/5: 20% soul_shard bloodlust, embrace_chaos, accelerando(2), potion_of_prolonged_power
0:03.790 default H berserking Fluffy_Pillow 951608.8/1100000: 87% mana | 1.0/5: 20% soul_shard bloodlust, embrace_chaos, accelerando(2), potion_of_prolonged_power
0:03.790 default J conflagrate Fluffy_Pillow 951608.8/1100000: 87% mana | 1.0/5: 20% soul_shard bloodlust, berserking, embrace_chaos, accelerando(2), potion_of_prolonged_power
0:04.549 default K conflagrate Fluffy_Pillow 968174.9/1100000: 88% mana | 2.0/5: 40% soul_shard bloodlust, berserking, conflagration_of_chaos, accelerando(2), potion_of_prolonged_power
0:05.310 default L service_imp Fluffy_Pillow 984784.7/1100000: 90% mana | 3.0/5: 60% soul_shard bloodlust, berserking, accelerando(2), potion_of_prolonged_power
0:06.071 default K conflagrate Fluffy_Pillow 1001394.5/1100000: 91% mana | 2.0/5: 40% soul_shard bloodlust, berserking, accelerando(2), potion_of_prolonged_power
0:06.831 default M summon_infernal Fluffy_Pillow 1018227.1/1100000: 93% mana | 4.0/5: 80% soul_shard bloodlust, berserking, conflagration_of_chaos, accelerando(3), potion_of_prolonged_power
0:07.586 default O soul_harvest Fluffy_Pillow 1034948.9/1100000: 94% mana | 3.0/5: 60% soul_shard bloodlust, berserking, lord_of_flames, conflagration_of_chaos, accelerando(3), potion_of_prolonged_power
0:07.586 default P dimensional_rift Fluffy_Pillow 1034948.9/1100000: 94% mana | 3.0/5: 60% soul_shard bloodlust, berserking, soul_harvest, lord_of_flames, conflagration_of_chaos, accelerando(3), potion_of_prolonged_power
0:08.340 default P dimensional_rift Fluffy_Pillow 1051648.6/1100000: 96% mana | 4.0/5: 80% soul_shard bloodlust, berserking, soul_harvest, lord_of_flames, conflagration_of_chaos, nefarious_pact, accelerando(3), potion_of_prolonged_power
0:09.095 default Q chaos_bolt Fluffy_Pillow 1068370.4/1100000: 97% mana | 5.0/5: 100% soul_shard bloodlust, berserking, soul_harvest, lord_of_flames, conflagration_of_chaos, nefarious_pact, accelerando(3), potion_of_prolonged_power
0:10.130 default Q chaos_bolt Fluffy_Pillow 1091293.7/1100000: 99% mana | 4.0/5: 80% soul_shard bloodlust, berserking, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(3), potion_of_prolonged_power
0:10.884 default Q chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard bloodlust, berserking, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(3), potion_of_prolonged_power
0:11.639 default K conflagrate Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard bloodlust, berserking, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(3), potion_of_prolonged_power
0:12.393 default Q chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard bloodlust, berserking, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, potion_of_prolonged_power
0:13.148 default K conflagrate Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard bloodlust, berserking, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, potion_of_prolonged_power
0:13.900 default Q chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard bloodlust, soul_harvest, lord_of_flames, embrace_chaos, nefarious_pact, accelerando, potion_of_prolonged_power
0:14.656 default R incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard bloodlust, soul_harvest, lord_of_flames, embrace_chaos, nefarious_pact, accelerando, potion_of_prolonged_power
0:15.412 default R incinerate Fluffy_Pillow 1034430.1/1100000: 94% mana | 1.0/5: 20% soul_shard bloodlust, soul_harvest, lord_of_flames, embrace_chaos, nefarious_pact, accelerando, potion_of_prolonged_power
0:16.168 default R incinerate Fluffy_Pillow 982566.6/1100000: 89% mana | 1.0/5: 20% soul_shard bloodlust, soul_harvest, lord_of_flames, embrace_chaos, nefarious_pact, accelerando, potion_of_prolonged_power
0:16.923 default R incinerate Fluffy_Pillow 930684.4/1100000: 85% mana | 1.0/5: 20% soul_shard bloodlust, soul_harvest, lord_of_flames, embrace_chaos, nefarious_pact, accelerando, potion_of_prolonged_power
0:17.676 default Q chaos_bolt Fluffy_Pillow 878764.8/1100000: 80% mana | 2.0/5: 40% soul_shard bloodlust, soul_harvest, lord_of_flames, embrace_chaos, nefarious_pact, accelerando, potion_of_prolonged_power
0:18.430 default K conflagrate Fluffy_Pillow 892863.8/1100000: 81% mana | 1.0/5: 20% soul_shard bloodlust, soul_harvest, lord_of_flames, embrace_chaos, nefarious_pact, accelerando, potion_of_prolonged_power
0:19.183 default Q chaos_bolt Fluffy_Pillow 906944.2/1100000: 82% mana | 2.0/5: 40% soul_shard bloodlust, soul_harvest, lord_of_flames, embrace_chaos, nefarious_pact, accelerando, potion_of_prolonged_power
0:19.938 default R incinerate Fluffy_Pillow 921062.0/1100000: 84% mana | 0.0/5: 0% soul_shard bloodlust, soul_harvest, lord_of_flames, embrace_chaos, devils_due, accelerando, potion_of_prolonged_power
0:21.189 default C havoc enemy2 878454.6/1100000: 80% mana | 0.0/5: 0% soul_shard bloodlust, soul_harvest, lord_of_flames, embrace_chaos, devils_due, accelerando, potion_of_prolonged_power
0:22.232 default R incinerate Fluffy_Pillow 809957.7/1100000: 74% mana | 1.0/5: 20% soul_shard bloodlust, soul_harvest, lord_of_flames, embrace_chaos, devils_due, accelerando, potion_of_prolonged_power
0:23.483 default R incinerate Fluffy_Pillow 767350.2/1100000: 70% mana | 1.0/5: 20% soul_shard bloodlust, soul_harvest, lord_of_flames, embrace_chaos, devils_due, accelerando, potion_of_prolonged_power
0:24.734 default R incinerate Fluffy_Pillow 724905.3/1100000: 66% mana | 1.0/5: 20% soul_shard bloodlust, soul_harvest, lord_of_flames, devils_due, accelerando(2), potion_of_prolonged_power
0:25.967 default E immolate Fluffy_Pillow 682261.4/1100000: 62% mana | 1.0/5: 20% soul_shard bloodlust, soul_harvest, lord_of_flames, devils_due, potion_of_prolonged_power
0:27.027 default Q chaos_bolt Fluffy_Pillow 635785.8/1100000: 58% mana | 3.0/5: 60% soul_shard bloodlust, lord_of_flames, devils_due, potion_of_prolonged_power
0:29.143 default Q chaos_bolt Fluffy_Pillow 674762.1/1100000: 61% mana | 3.0/5: 60% soul_shard bloodlust, lord_of_flames, embrace_chaos, accelerando, potion_of_prolonged_power
0:30.206 default Q chaos_bolt Fluffy_Pillow 694639.2/1100000: 63% mana | 2.0/5: 40% soul_shard bloodlust, lord_of_flames, embrace_chaos, accelerando, potion_of_prolonged_power
0:31.268 default R incinerate Fluffy_Pillow 714555.9/1100000: 65% mana | 0.0/5: 0% soul_shard bloodlust, lord_of_flames, embrace_chaos, accelerando(2), potion_of_prolonged_power
0:32.316 default G immolate Fluffy_Pillow 668446.3/1100000: 61% mana | 0.0/5: 0% soul_shard bloodlust, lord_of_flames, embrace_chaos, accelerando(2), potion_of_prolonged_power
0:33.188 default J conflagrate Fluffy_Pillow 618996.2/1100000: 56% mana | 0.0/5: 0% soul_shard bloodlust, lord_of_flames, embrace_chaos, accelerando(2), potion_of_prolonged_power
0:34.062 default K conflagrate Fluffy_Pillow 635584.2/1100000: 58% mana | 1.0/5: 20% soul_shard bloodlust, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2), potion_of_prolonged_power
0:34.935 default K conflagrate Fluffy_Pillow 652153.2/1100000: 59% mana | 2.0/5: 40% soul_shard bloodlust, lord_of_flames, embrace_chaos, accelerando(2), potion_of_prolonged_power
0:35.805 default Q chaos_bolt Fluffy_Pillow 668665.2/1100000: 61% mana | 3.0/5: 60% soul_shard bloodlust, lord_of_flames, accelerando(2), potion_of_prolonged_power
0:37.547 default R incinerate Fluffy_Pillow 701727.2/1100000: 64% mana | 1.0/5: 20% soul_shard bloodlust, lord_of_flames, embrace_chaos, accelerando(2), potion_of_prolonged_power
0:38.595 default R incinerate Fluffy_Pillow 655617.5/1100000: 60% mana | 1.0/5: 20% soul_shard bloodlust, lord_of_flames, embrace_chaos, accelerando(2), potion_of_prolonged_power
0:39.642 default K conflagrate Fluffy_Pillow 609488.9/1100000: 55% mana | 1.0/5: 20% soul_shard bloodlust, lord_of_flames, embrace_chaos, accelerando(2), potion_of_prolonged_power
0:40.516 default Q chaos_bolt Fluffy_Pillow 626076.9/1100000: 57% mana | 2.0/5: 40% soul_shard bloodlust, lord_of_flames, embrace_chaos, accelerando(2), potion_of_prolonged_power
0:41.564 default C havoc enemy2 641209.9/1100000: 58% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos, accelerando, potion_of_prolonged_power
0:42.715 default R incinerate Fluffy_Pillow 569765.8/1100000: 52% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos, accelerando, potion_of_prolonged_power
0:44.095 default P dimensional_rift Fluffy_Pillow 523615.6/1100000: 48% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos, accelerando, potion_of_prolonged_power
0:45.246 default K conflagrate Fluffy_Pillow 540171.4/1100000: 49% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos, accelerando, potion_of_prolonged_power
0:46.468 default P dimensional_rift Fluffy_Pillow 557748.5/1100000: 51% mana | 1.0/5: 20% soul_shard lord_of_flames, accelerando, potion_of_prolonged_power
0:47.622 default R incinerate Fluffy_Pillow 574347.5/1100000: 52% mana | 1.0/5: 20% soul_shard lord_of_flames, accelerando, potion_of_prolonged_power
0:49.003 default P dimensional_rift Fluffy_Pillow 528211.7/1100000: 48% mana | 1.0/5: 20% soul_shard lord_of_flames, accelerando, potion_of_prolonged_power
0:50.156 default R incinerate Fluffy_Pillow 544796.3/1100000: 50% mana | 1.0/5: 20% soul_shard lord_of_flames, accelerando, potion_of_prolonged_power
0:51.536 default Q chaos_bolt Fluffy_Pillow 498828.5/1100000: 45% mana | 2.0/5: 40% soul_shard lord_of_flames, accelerando(2), potion_of_prolonged_power
0:53.799 default R incinerate Fluffy_Pillow 531733.1/1100000: 48% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos, potion_of_prolonged_power
0:55.202 default E immolate Fluffy_Pillow 485613.0/1100000: 44% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos, accelerando, potion_of_prolonged_power
0:56.353 default R incinerate Fluffy_Pillow 436169.7/1100000: 40% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos, accelerando(2), potion_of_prolonged_power
0:57.713 default R incinerate Fluffy_Pillow 390025.9/1100000: 35% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos, accelerando(3), potion_of_prolonged_power
0:59.053 default R incinerate Fluffy_Pillow 343877.7/1100000: 31% mana | 0.0/5: 0% soul_shard lord_of_flames, accelerando(3)
1:00.394 default P dimensional_rift Fluffy_Pillow 297744.3/1100000: 27% mana | 0.0/5: 0% soul_shard lord_of_flames, accelerando(3)
1:01.512 default R incinerate Fluffy_Pillow 314307.3/1100000: 29% mana | 1.0/5: 20% soul_shard lord_of_flames, accelerando(3)
1:02.853 default C havoc enemy2 268175.0/1100000: 24% mana | 1.0/5: 20% soul_shard lord_of_flames, accelerando(4)
1:03.954 default Q chaos_bolt Fluffy_Pillow 196723.5/1100000: 18% mana | 3.0/5: 60% soul_shard lord_of_flames, nefarious_pact, accelerando(4)
1:05.479 default G immolate Fluffy_Pillow 219786.7/1100000: 20% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, nefarious_pact, accelerando(5)
1:06.235 default J conflagrate Fluffy_Pillow 165312.5/1100000: 15% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, nefarious_pact, accelerando(5)
1:06.990 default K conflagrate Fluffy_Pillow 176823.0/1100000: 16% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(5)
1:07.745 default Q chaos_bolt Fluffy_Pillow 187742.2/1100000: 17% mana | 4.0/5: 80% soul_shard lord_of_flames, embrace_chaos, nefarious_pact
1:08.717 default Q chaos_bolt Fluffy_Pillow 201514.0/1100000: 18% mana | 3.0/5: 60% soul_shard lord_of_flames, embrace_chaos, nefarious_pact
1:09.688 default K conflagrate Fluffy_Pillow 215271.7/1100000: 20% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, nefarious_pact
1:10.497 default Q chaos_bolt Fluffy_Pillow 226734.1/1100000: 21% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact
1:11.469 default R incinerate Fluffy_Pillow 240592.7/1100000: 22% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando
1:12.425 default R incinerate Fluffy_Pillow 188343.7/1100000: 17% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando
1:13.382 default K conflagrate Fluffy_Pillow 136126.2/1100000: 12% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(3)
1:14.157 default Q chaos_bolt Fluffy_Pillow 147607.6/1100000: 13% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(3)
1:15.087 default R incinerate Fluffy_Pillow 161385.4/1100000: 15% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(3)
1:16.017 default R incinerate Fluffy_Pillow 109163.2/1100000: 10% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due, accelerando(3)
1:17.597 default Q chaos_bolt Fluffy_Pillow 66570.5/1100000: 6% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due, accelerando(3)
1:19.177 default R incinerate Fluffy_Pillow 89977.9/1100000: 8% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due, accelerando(3)
1:20.756 default K conflagrate Fluffy_Pillow 47370.5/1100000: 4% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due, accelerando(3)
1:22.074 default Q chaos_bolt Fluffy_Pillow 66896.4/1100000: 6% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, devils_due, accelerando(3)
1:23.652 default C havoc enemy2 89896.3/1100000: 8% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos, accelerando
1:24.804 default S life_tap Fluffy_Pillow 18572.9/1100000: 2% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos, accelerando(2)
1:25.939 default R incinerate Fluffy_Pillow 365143.3/1100000: 33% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos, accelerando(2)
1:27.298 default R incinerate Fluffy_Pillow 319268.4/1100000: 29% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando(3)
1:28.641 default E immolate Fluffy_Pillow 273164.7/1100000: 25% mana | 1.0/5: 20% soul_shard lord_of_flames, accelerando(3)
1:29.758 default R incinerate Fluffy_Pillow 223740.9/1100000: 20% mana | 1.0/5: 20% soul_shard lord_of_flames, accelerando(4)
1:31.080 default P dimensional_rift Fluffy_Pillow 177611.1/1100000: 16% mana | 1.0/5: 20% soul_shard lord_of_flames, accelerando(4)
1:32.255 default Q chaos_bolt Fluffy_Pillow 195271.8/1100000: 18% mana | 2.0/5: 40% soul_shard lord_of_flames, accelerando(4)
1:34.453 default R incinerate Fluffy_Pillow 228375.1/1100000: 21% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando(5)
1:35.755 default L service_imp Fluffy_Pillow 182109.8/1100000: 17% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos
1:36.926 default R incinerate Fluffy_Pillow 198701.2/1100000: 18% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos
1:38.327 default G immolate Fluffy_Pillow 152551.4/1100000: 14% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos
1:39.496 default J conflagrate Fluffy_Pillow 103114.5/1100000: 9% mana | 1.0/5: 20% soul_shard lord_of_flames
1:40.666 default K conflagrate Fluffy_Pillow 119691.7/1100000: 11% mana | 2.0/5: 40% soul_shard lord_of_flames
1:41.834 default Q chaos_bolt Fluffy_Pillow 136679.2/1100000: 12% mana | 3.0/5: 60% soul_shard lord_of_flames, accelerando(2)
1:44.098 default C havoc enemy2 169732.5/1100000: 15% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando(2)
1:45.233 default K conflagrate Fluffy_Pillow 98302.9/1100000: 9% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando(2)
1:46.367 default Q chaos_bolt Fluffy_Pillow 114858.7/1100000: 10% mana | 4.0/5: 80% soul_shard lord_of_flames, embrace_chaos, accelerando(2)
1:47.729 default K conflagrate Fluffy_Pillow 134744.5/1100000: 12% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando(3)
1:48.846 default Q chaos_bolt Fluffy_Pillow 151292.7/1100000: 14% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
1:50.186 default R incinerate Fluffy_Pillow 171144.5/1100000: 16% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
1:51.526 default R incinerate Fluffy_Pillow 124996.3/1100000: 11% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
1:52.867 default R incinerate Fluffy_Pillow 78826.9/1100000: 7% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
1:54.269 default K conflagrate Fluffy_Pillow 32691.2/1100000: 3% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos
1:55.439 default Q chaos_bolt Fluffy_Pillow 49486.0/1100000: 4% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, accelerando
1:57.738 default R incinerate Fluffy_Pillow 82767.1/1100000: 8% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
1:59.098 default S life_tap Fluffy_Pillow 36622.4/1100000: 3% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
2:00.232 default R incinerate Fluffy_Pillow 383178.2/1100000: 35% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
2:01.591 default E immolate Fluffy_Pillow 337019.0/1100000: 31% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
2:02.724 default R incinerate Fluffy_Pillow 287560.2/1100000: 26% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, accelerando(2)
2:04.084 default Q chaos_bolt Fluffy_Pillow 241415.5/1100000: 22% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, accelerando(2)
2:06.348 default C havoc enemy2 274469.6/1100000: 25% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
2:07.466 default O soul_harvest Fluffy_Pillow 202362.4/1100000: 18% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
2:07.586 default I potion Fluffy_Pillow 204062.7/1100000: 19% mana | 0.0/5: 0% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos
2:07.586 default R incinerate Fluffy_Pillow 204062.7/1100000: 19% mana | 0.0/5: 0% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, potion_of_deadly_grace
2:08.987 default R incinerate Fluffy_Pillow 157912.8/1100000: 14% mana | 0.0/5: 0% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, potion_of_deadly_grace
2:10.389 default R incinerate Fluffy_Pillow 111778.3/1100000: 10% mana | 0.0/5: 0% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, accelerando, potion_of_deadly_grace
2:11.770 default S life_tap Fluffy_Pillow 65643.5/1100000: 6% mana | 0.0/5: 0% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, accelerando(2), potion_of_deadly_grace
2:12.904 default G immolate Fluffy_Pillow 412199.3/1100000: 37% mana | 0.0/5: 0% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, accelerando(2), potion_of_deadly_grace
2:14.040 default J conflagrate Fluffy_Pillow 362784.4/1100000: 33% mana | 0.0/5: 0% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, accelerando(2), potion_of_deadly_grace
2:15.173 default K conflagrate Fluffy_Pillow 379325.6/1100000: 34% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, accelerando(2), potion_of_deadly_grace
2:16.308 default K conflagrate Fluffy_Pillow 395896.0/1100000: 36% mana | 2.0/5: 40% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, accelerando(2), potion_of_deadly_grace
2:17.442 default P dimensional_rift Fluffy_Pillow 412696.0/1100000: 38% mana | 5.0/5: 100% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, accelerando(3), potion_of_deadly_grace
2:18.560 default Q chaos_bolt Fluffy_Pillow 429258.9/1100000: 39% mana | 5.0/5: 100% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, accelerando(3), potion_of_deadly_grace
2:20.793 default Q chaos_bolt Fluffy_Pillow 462766.6/1100000: 42% mana | 3.0/5: 60% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(4), potion_of_deadly_grace
2:22.116 default K conflagrate Fluffy_Pillow 482889.8/1100000: 44% mana | 2.0/5: 40% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(5), potion_of_deadly_grace
2:23.203 default Q chaos_bolt Fluffy_Pillow 498579.7/1100000: 45% mana | 3.0/5: 60% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, potion_of_deadly_grace
2:24.605 default Q chaos_bolt Fluffy_Pillow 518746.3/1100000: 47% mana | 4.0/5: 80% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2), potion_of_deadly_grace
2:25.966 default Q chaos_bolt Fluffy_Pillow 538616.3/1100000: 49% mana | 3.0/5: 60% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2), potion_of_deadly_grace
2:27.329 default C havoc enemy2 558515.4/1100000: 51% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2), potion_of_deadly_grace
2:28.463 default Q chaos_bolt Fluffy_Pillow 487071.2/1100000: 44% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2), potion_of_deadly_grace
2:29.822 default K conflagrate Fluffy_Pillow 506911.9/1100000: 46% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2), potion_of_deadly_grace
2:30.956 default Q chaos_bolt Fluffy_Pillow 523467.7/1100000: 48% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2), potion_of_deadly_grace
2:32.319 default Q chaos_bolt Fluffy_Pillow 543375.0/1100000: 49% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3), potion_of_deadly_grace
2:33.660 default R incinerate Fluffy_Pillow 563241.7/1100000: 51% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3), potion_of_deadly_grace
2:34.999 default R incinerate Fluffy_Pillow 517078.7/1100000: 47% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3), potion_of_deadly_grace
2:36.340 default E immolate Fluffy_Pillow 470212.5/1100000: 43% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, potion_of_deadly_grace
2:37.509 default Q chaos_bolt Fluffy_Pillow 420791.7/1100000: 38% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando, potion_of_deadly_grace
2:38.889 default R incinerate Fluffy_Pillow 440642.4/1100000: 40% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
2:40.249 default R incinerate Fluffy_Pillow 394594.8/1100000: 36% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
2:41.589 default R incinerate Fluffy_Pillow 348446.6/1100000: 32% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
2:42.929 default R incinerate Fluffy_Pillow 302298.5/1100000: 27% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, accelerando(3)
2:44.268 default R incinerate Fluffy_Pillow 256135.5/1100000: 23% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, accelerando(3)
2:45.608 default G immolate Fluffy_Pillow 209987.3/1100000: 19% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, accelerando(3)
2:46.723 default Q chaos_bolt Fluffy_Pillow 160505.8/1100000: 15% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, nefarious_pact, accelerando(3)
2:48.271 default C havoc enemy2 183485.7/1100000: 17% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(4)
2:49.037 default J conflagrate Fluffy_Pillow 106999.0/1100000: 10% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(4)
2:49.802 default K conflagrate Fluffy_Pillow 118180.1/1100000: 11% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact
2:50.611 default K conflagrate Fluffy_Pillow 129642.5/1100000: 12% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, nefarious_pact
2:51.422 default Q chaos_bolt Fluffy_Pillow 141133.2/1100000: 13% mana | 4.0/5: 80% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact
2:52.395 default Q chaos_bolt Fluffy_Pillow 155038.7/1100000: 14% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando
2:53.353 default R incinerate Fluffy_Pillow 168932.5/1100000: 15% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(2)
2:54.299 default R incinerate Fluffy_Pillow 116745.2/1100000: 11% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(3)
2:55.231 default S life_tap Fluffy_Pillow 64552.6/1100000: 6% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(3)
2:56.005 default K conflagrate Fluffy_Pillow 406019.2/1100000: 37% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(3)
2:56.779 default Q chaos_bolt Fluffy_Pillow 417485.9/1100000: 38% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(3)
2:57.708 default R incinerate Fluffy_Pillow 431248.8/1100000: 39% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(3)
2:58.638 default R incinerate Fluffy_Pillow 379026.6/1100000: 34% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due, accelerando(3)
3:00.217 default R incinerate Fluffy_Pillow 336541.8/1100000: 31% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due, accelerando(4)
3:01.772 default P dimensional_rift Fluffy_Pillow 293914.1/1100000: 27% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, devils_due, accelerando(4)
3:03.069 default K conflagrate Fluffy_Pillow 313408.5/1100000: 28% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, devils_due, accelerando(4)
3:04.367 default H berserking Fluffy_Pillow 332463.8/1100000: 30% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, devils_due
3:04.367 default Q chaos_bolt Fluffy_Pillow 332463.8/1100000: 30% mana | 3.0/5: 60% soul_shard berserking, lord_of_flames, conflagration_of_chaos, devils_due
3:06.757 default L service_imp Fluffy_Pillow 371407.2/1100000: 34% mana | 2.0/5: 40% soul_shard berserking, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
3:07.760 default R incinerate Fluffy_Pillow 387998.3/1100000: 35% mana | 1.0/5: 20% soul_shard berserking, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
3:08.960 default C havoc enemy2 341848.0/1100000: 31% mana | 1.0/5: 20% soul_shard berserking, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
3:09.961 default E immolate Fluffy_Pillow 270406.1/1100000: 25% mana | 2.0/5: 40% soul_shard berserking, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
3:10.964 default Q chaos_bolt Fluffy_Pillow 220997.2/1100000: 20% mana | 3.0/5: 60% soul_shard berserking, lord_of_flames, conflagration_of_chaos, accelerando
3:12.963 default R incinerate Fluffy_Pillow 254066.3/1100000: 23% mana | 1.0/5: 20% soul_shard berserking, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
3:14.146 default R incinerate Fluffy_Pillow 207928.2/1100000: 19% mana | 1.0/5: 20% soul_shard berserking, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
3:15.331 default R incinerate Fluffy_Pillow 159713.9/1100000: 15% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
3:16.672 default R incinerate Fluffy_Pillow 113580.5/1100000: 10% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
3:18.013 default R incinerate Fluffy_Pillow 67627.4/1100000: 6% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, accelerando(4)
3:19.334 default J conflagrate Fluffy_Pillow 20982.7/1100000: 2% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, accelerando
3:20.484 default K conflagrate Fluffy_Pillow 37524.2/1100000: 3% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, accelerando
3:21.635 default Q chaos_bolt Fluffy_Pillow 54328.2/1100000: 5% mana | 3.0/5: 60% soul_shard lord_of_flames, accelerando(2)
3:23.900 default Q chaos_bolt Fluffy_Pillow 87396.0/1100000: 8% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando(2)
3:25.260 default R incinerate Fluffy_Pillow 107252.2/1100000: 10% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos, accelerando(3)
3:26.601 default S life_tap Fluffy_Pillow 61202.1/1100000: 6% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando(4)
3:27.702 default E immolate Fluffy_Pillow 407750.6/1100000: 37% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando(4)
3:28.802 default R incinerate Fluffy_Pillow 358367.7/1100000: 33% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando(5)
3:30.104 default C havoc enemy2 312217.7/1100000: 28% mana | 1.0/5: 20% soul_shard lord_of_flames, accelerando(5)
3:31.190 default Q chaos_bolt Fluffy_Pillow 240774.5/1100000: 22% mana | 2.0/5: 40% soul_shard lord_of_flames, accelerando(5)
3:33.360 default G immolate Fluffy_Pillow 271687.1/1100000: 25% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando
3:34.511 default J conflagrate Fluffy_Pillow 222243.8/1100000: 20% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando(2)
3:35.645 default K conflagrate Fluffy_Pillow 238799.6/1100000: 22% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando(2)
3:36.779 default Q chaos_bolt Fluffy_Pillow 255355.4/1100000: 23% mana | 3.0/5: 60% soul_shard lord_of_flames, embrace_chaos, accelerando(2)
3:38.139 default K conflagrate Fluffy_Pillow 275210.7/1100000: 25% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, nefarious_pact, accelerando(2)
3:38.928 default Q chaos_bolt Fluffy_Pillow 286729.7/1100000: 26% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, nefarious_pact, accelerando(2)
3:39.873 default R incinerate Fluffy_Pillow 300619.3/1100000: 27% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, nefarious_pact, accelerando(3)
3:40.802 default R incinerate Fluffy_Pillow 248382.2/1100000: 23% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, nefarious_pact, accelerando(3)
3:41.731 default K conflagrate Fluffy_Pillow 196145.2/1100000: 18% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, nefarious_pact, accelerando(3)
3:42.506 default Q chaos_bolt Fluffy_Pillow 207626.6/1100000: 19% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(3)
3:43.435 default R incinerate Fluffy_Pillow 221389.6/1100000: 20% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(3)
3:44.365 default R incinerate Fluffy_Pillow 169226.0/1100000: 15% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(4)
3:45.281 default R incinerate Fluffy_Pillow 116993.8/1100000: 11% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(4)
3:46.197 default P dimensional_rift Fluffy_Pillow 63976.6/1100000: 6% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact
3:47.007 default R incinerate Fluffy_Pillow 75453.1/1100000: 7% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact
3:47.978 default K conflagrate Fluffy_Pillow 23367.8/1100000: 2% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, nefarious_pact, accelerando
3:48.836 default Q chaos_bolt Fluffy_Pillow 35709.2/1100000: 3% mana | 2.0/5: 40% soul_shard lord_of_flames, nefarious_pact, accelerando
3:50.431 default S life_tap Fluffy_Pillow 58651.5/1100000: 5% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, devils_due, accelerando
3:51.787 default C havoc enemy2 408316.9/1100000: 37% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, devils_due, accelerando(2)
3:53.123 default R incinerate Fluffy_Pillow 339821.8/1100000: 31% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, devils_due, accelerando(2)
3:54.725 default N summon_doomguard Fluffy_Pillow 297210.2/1100000: 27% mana | 1.0/5: 20% soul_shard lord_of_flames, devils_due, accelerando(2)
3:56.060 default E immolate Fluffy_Pillow 316700.5/1100000: 29% mana | 0.0/5: 0% soul_shard lord_of_flames, devils_due, accelerando(2)
3:57.395 default R incinerate Fluffy_Pillow 270191.7/1100000: 25% mana | 0.0/5: 0% soul_shard lord_of_flames, devils_due, accelerando(3)
3:58.974 default Q chaos_bolt Fluffy_Pillow 227584.3/1100000: 21% mana | 2.0/5: 40% soul_shard lord_of_flames, accelerando(3)
4:01.205 default Q chaos_bolt Fluffy_Pillow 259373.0/1100000: 24% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando
4:02.584 default R incinerate Fluffy_Pillow 279234.4/1100000: 25% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando(2)
4:03.945 default R incinerate Fluffy_Pillow 233104.3/1100000: 21% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando(2)
4:05.306 default R incinerate Fluffy_Pillow 186974.3/1100000: 17% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando(2)
4:06.667 default G immolate Fluffy_Pillow 140844.2/1100000: 13% mana | 1.0/5: 20% soul_shard lord_of_flames, accelerando(2)
4:07.802 default J conflagrate Fluffy_Pillow 91414.6/1100000: 8% mana | 2.0/5: 40% soul_shard lord_of_flames, accelerando(2)
4:08.935 default O soul_harvest Fluffy_Pillow 107955.8/1100000: 10% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, accelerando(2)
4:08.935 default Q chaos_bolt Fluffy_Pillow 107955.8/1100000: 10% mana | 3.0/5: 60% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, accelerando(2)
4:11.201 default K conflagrate Fluffy_Pillow 141039.6/1100000: 13% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
4:12.318 default C havoc enemy2 157587.7/1100000: 14% mana | 3.0/5: 60% soul_shard soul_harvest, lord_of_flames, embrace_chaos, accelerando(3)
4:13.436 default Q chaos_bolt Fluffy_Pillow 85998.8/1100000: 8% mana | 3.0/5: 60% soul_shard soul_harvest, lord_of_flames, embrace_chaos
4:14.838 default K conflagrate Fluffy_Pillow 105864.2/1100000: 10% mana | 2.0/5: 40% soul_shard soul_harvest, lord_of_flames, embrace_chaos, accelerando
4:15.992 default Q chaos_bolt Fluffy_Pillow 122463.2/1100000: 11% mana | 3.0/5: 60% soul_shard soul_harvest, lord_of_flames, embrace_chaos, accelerando
4:17.373 default K conflagrate Fluffy_Pillow 142328.5/1100000: 13% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, embrace_chaos, accelerando(2)
4:18.507 default Q chaos_bolt Fluffy_Pillow 158884.3/1100000: 14% mana | 2.0/5: 40% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
4:19.869 default R incinerate Fluffy_Pillow 178770.1/1100000: 16% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
4:21.209 default Q chaos_bolt Fluffy_Pillow 132750.4/1100000: 12% mana | 3.0/5: 60% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(4)
4:22.531 default K conflagrate Fluffy_Pillow 152620.6/1100000: 14% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(4)
4:23.632 default Q chaos_bolt Fluffy_Pillow 169169.1/1100000: 15% mana | 2.0/5: 40% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(4)
4:24.952 default R incinerate Fluffy_Pillow 189009.2/1100000: 17% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(4)
4:26.274 default R incinerate Fluffy_Pillow 143146.2/1100000: 13% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(5)
4:27.577 default R incinerate Fluffy_Pillow 96209.9/1100000: 9% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos
4:28.982 default S life_tap Fluffy_Pillow 50118.5/1100000: 5% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, accelerando
4:30.135 default E immolate Fluffy_Pillow 396703.2/1100000: 36% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, accelerando
4:31.289 default P dimensional_rift Fluffy_Pillow 347322.0/1100000: 32% mana | 4.0/5: 80% soul_shard lord_of_flames, conflagration_of_chaos, accelerando(2)
4:32.424 default C havoc enemy2 363892.4/1100000: 33% mana | 4.0/5: 80% soul_shard lord_of_flames, conflagration_of_chaos, accelerando(2)
4:33.558 default Q chaos_bolt Fluffy_Pillow 292448.3/1100000: 27% mana | 4.0/5: 80% soul_shard lord_of_flames, conflagration_of_chaos, accelerando(2)
4:35.822 default Q chaos_bolt Fluffy_Pillow 325505.8/1100000: 30% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
4:37.164 default G immolate Fluffy_Pillow 345388.6/1100000: 31% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(4)
4:38.266 default J conflagrate Fluffy_Pillow 295952.1/1100000: 27% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(4)
4:39.369 default J conflagrate Fluffy_Pillow 312530.6/1100000: 28% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando(4)
4:40.471 default L service_imp Fluffy_Pillow 329331.4/1100000: 30% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(5)
4:41.558 default Q chaos_bolt Fluffy_Pillow 345274.4/1100000: 31% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos
4:43.892 default J conflagrate Fluffy_Pillow 378345.0/1100000: 34% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
4:45.043 default R incinerate Fluffy_Pillow 394900.8/1100000: 36% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando
4:46.424 default R incinerate Fluffy_Pillow 348765.0/1100000: 32% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando
4:47.806 default Q chaos_bolt Fluffy_Pillow 302644.8/1100000: 28% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando(2)
4:49.167 default R incinerate Fluffy_Pillow 322514.7/1100000: 29% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos, accelerando(2)
4:50.528 default J conflagrate Fluffy_Pillow 276384.6/1100000: 25% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos, accelerando(2)
4:51.662 default R incinerate Fluffy_Pillow 292940.5/1100000: 27% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando(2)
4:53.022 default C havoc enemy2 246795.8/1100000: 22% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando(2)
4:54.156 default R incinerate Fluffy_Pillow 175422.9/1100000: 16% mana | 1.0/5: 20% soul_shard lord_of_flames, accelerando(3)
4:55.495 default R incinerate Fluffy_Pillow 129260.5/1100000: 12% mana | 1.0/5: 20% soul_shard lord_of_flames, accelerando(4)
4:56.817 default J conflagrate Fluffy_Pillow 82329.2/1100000: 7% mana | 3.0/5: 60% soul_shard lord_of_flames
4:57.985 default Q chaos_bolt Fluffy_Pillow 98878.1/1100000: 9% mana | 4.0/5: 80% soul_shard lord_of_flames
5:00.317 default E immolate Fluffy_Pillow 131919.3/1100000: 12% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos
5:01.488 default Q chaos_bolt Fluffy_Pillow 82510.7/1100000: 8% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4201 3876 0
Agility 7254 6929 0
Stamina 52586 52586 34192
Intellect 49775 48068 38456 (1278)
Spirit 1 1 0
Health 3155160 3155160 0
Mana 1100000 1100000 0
Soul Shard 5 5 0
Spell Power 49775 48068 0
Crit 15.38% 15.38% 4150
Haste 28.81% 27.81% 10427
Damage / Heal Versatility 5.96% 5.96% 2829
ManaReg per Second 14169 14059 0
Mastery 77.34% 77.34% 7113
Armor 1954 1954 1954
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 906.00
Local Head Eyes of Azj'Aqir
ilevel: 900, stats: { 253 Armor, +3255 Sta, +2170 Int, +1074 Haste, +578 Vers }
Local Neck Prydaz, Xavaric's Magnum Opus
ilevel: 940, stats: { +2658 Sta, +1495 Mastery, +1495 Crit, +1495 Haste }, enchant: mark_of_the_hidden_satyr
Local Shoulders Pauldrons of Azj'Aqir
ilevel: 900, stats: { 233 Armor, +2442 Sta, +1628 Int, +752 Mastery, +487 Vers }
Local Chest Robes of Fluctuating Energy
ilevel: 900, stats: { 311 Armor, +3255 Sta, +2170 Int, +1145 Haste, +507 Mastery }
Local Waist Man'ari Skullbuckled Cinch
ilevel: 900, stats: { 175 Armor, +2442 Sta, +1628 Int, +699 Haste, +540 Mastery }
Local Legs Leggings of Azj'Aqir
ilevel: 900, stats: { 272 Armor, +3255 Sta, +2170 Int, +932 Crit, +720 Haste }
Local Feet Outcast Wanderer's Footrags
ilevel: 910, stats: { 222 Armor, +2680 Sta, +1786 Int, +864 Crit, +422 Mastery }
Local Wrists Woven Lasher Tendril Bracers
ilevel: 900, stats: { 136 Armor, +1831 Sta, +1221 Int, +644 Haste, +285 Vers }
Local Hands Clutch of Azj'Aqir
ilevel: 900, stats: { 194 Armor, +2442 Sta, +1628 Int, +859 Crit, +380 Mastery }
Local Finger1 Ring of the Scoured Clan
ilevel: 900, stats: { +1831 Sta, +2095 Mastery, +838 Haste }, enchant: { +200 Haste }
Local Finger2 Ring of Braided Stems
ilevel: 905, stats: { +1918 Sta, +1814 Haste, +1209 Vers }, enchant: { +200 Haste }
Local Trinket1 Whispers in the Dark
ilevel: 905, stats: { +2162 Int }
Local Trinket2 Erratic Metronome
ilevel: 900, stats: { +2063 Int }
Local Back Astromancer's Greatcloak
ilevel: 905, stats: { 158 Armor, +1918 Sta, +1278 StrAgiInt, +676 Haste, +270 Vers }, enchant: { +200 Int }
Local Main Hand Scepter of Sargeras
ilevel: 929, weapon: { 7005 - 10509, 3.6 }, stats: { +2843 Int, +4265 Sta, +922 Haste, +922 Mastery, +15509 Int }, relics: { +61 ilevels, +59 ilevels, +61 ilevels }

Talents

Level
15 Backdraft (Destruction Warlock) Roaring Blaze (Destruction Warlock) Shadowburn (Destruction Warlock)
30 Reverse Entropy (Destruction Warlock) Eradication (Destruction Warlock) Empowered Life Tap
45 Demonic Circle Mortal Coil Shadowfury
60 Cataclysm (Destruction Warlock) Fire and Brimstone (Destruction Warlock) Soul Harvest
75 Demon Skin Burning Rush Dark Pact
90 Grimoire of Supremacy Grimoire of Service Grimoire of Sacrifice
100 Wreak Havoc (Destruction Warlock) Channel Demonfire (Destruction Warlock) Soul Conduit

Profile

warlock="Prydaz"
level=110
race=troll
role=spell
position=back
talents=2203021
artifact=38:142513:142516:142513:0:803:1:804:3:805:3:806:5:807:3:808:3:809:4:810:3:811:3:812:3:813:1:814:1:815:1:816:1:817:1:818:1:1355:1
spec=destruction

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,type=whispered_pact
actions.precombat+=/food,type=azshari_salad
actions.precombat+=/summon_pet,if=!talent.grimoire_of_supremacy.enabled&(!talent.grimoire_of_sacrifice.enabled|buff.demonic_power.down)
actions.precombat+=/summon_infernal,if=talent.grimoire_of_supremacy.enabled&artifact.lord_of_flames.rank>0
actions.precombat+=/summon_infernal,if=talent.grimoire_of_supremacy.enabled&active_enemies>1
actions.precombat+=/summon_doomguard,if=talent.grimoire_of_supremacy.enabled&active_enemies=1&artifact.lord_of_flames.rank=0
actions.precombat+=/augmentation,type=defiled
actions.precombat+=/snapshot_stats
actions.precombat+=/grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
actions.precombat+=/life_tap,if=talent.empowered_life_tap.enabled&!buff.empowered_life_tap.remains
actions.precombat+=/potion,name=prolonged_power
actions.precombat+=/chaos_bolt

# Executed every time the actor is available.
actions=havoc,target=2,if=active_enemies>1&(active_enemies<4|talent.wreak_havoc.enabled&active_enemies<6)&!debuff.havoc.remains
actions+=/dimensional_rift,if=charges=3
actions+=/immolate,if=remains<=tick_time
actions+=/immolate,cycle_targets=1,if=active_enemies>1&remains<=tick_time&(!talent.roaring_blaze.enabled|(!debuff.roaring_blaze.remains&action.conflagrate.charges<2))
actions+=/immolate,if=talent.roaring_blaze.enabled&remains<=duration&!debuff.roaring_blaze.remains&target.time_to_die>10&(action.conflagrate.charges=2+set_bonus.tier19_4pc|(action.conflagrate.charges>=1+set_bonus.tier19_4pc&action.conflagrate.recharge_time<cast_time+gcd)|target.time_to_die<24)
actions+=/berserking
actions+=/blood_fury
actions+=/arcane_torrent
actions+=/potion,name=deadly_grace,if=(buff.soul_harvest.remains|trinket.proc.any.react|target.time_to_die<=45)
actions+=/shadowburn,if=buff.conflagration_of_chaos.remains<=action.chaos_bolt.cast_time
actions+=/shadowburn,if=(charges=1&recharge_time<action.chaos_bolt.cast_time|charges=2)&soul_shard<5
actions+=/conflagrate,if=talent.roaring_blaze.enabled&(charges=2+set_bonus.tier19_4pc|(charges>=1+set_bonus.tier19_4pc&recharge_time<gcd)|target.time_to_die<24)
actions+=/conflagrate,if=talent.roaring_blaze.enabled&debuff.roaring_blaze.stack>0&dot.immolate.remains>dot.immolate.duration*0.3&(active_enemies=1|soul_shard<3)&soul_shard<5
actions+=/conflagrate,if=!talent.roaring_blaze.enabled&!buff.backdraft.remains&buff.conflagration_of_chaos.remains<=action.chaos_bolt.cast_time
actions+=/conflagrate,if=!talent.roaring_blaze.enabled&!buff.backdraft.remains&(charges=1&recharge_time<action.chaos_bolt.cast_time|charges=2)&soul_shard<5
actions+=/life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<=gcd
actions+=/dimensional_rift,if=equipped.144369&!buff.lessons_of_spacetime.remains&((!talent.grimoire_of_supremacy.enabled&!cooldown.summon_doomguard.remains)|(talent.grimoire_of_service.enabled&!cooldown.service_pet.remains)|(talent.soul_harvest.enabled&!cooldown.soul_harvest.remains))
actions+=/service_pet
actions+=/summon_infernal,if=artifact.lord_of_flames.rank>0&!buff.lord_of_flames.remains
actions+=/summon_doomguard,if=!talent.grimoire_of_supremacy.enabled&spell_targets.infernal_awakening<=2&(target.time_to_die>180|target.health.pct<=20|target.time_to_die<30)
actions+=/summon_infernal,if=!talent.grimoire_of_supremacy.enabled&spell_targets.infernal_awakening>2
actions+=/summon_doomguard,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal=1&artifact.lord_of_flames.rank>0&buff.lord_of_flames.remains&!pet.doomguard.active
actions+=/summon_doomguard,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal=1&equipped.132379&!cooldown.sindorei_spite_icd.remains
actions+=/summon_infernal,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal>1&equipped.132379&!cooldown.sindorei_spite_icd.remains
actions+=/soul_harvest
actions+=/channel_demonfire,if=dot.immolate.remains>cast_time
actions+=/havoc,if=active_enemies=1&talent.wreak_havoc.enabled&equipped.132375&!debuff.havoc.remains
actions+=/rain_of_fire,if=active_enemies>=3&cooldown.havoc.remains<=12&!talent.wreak_havoc.enabled
actions+=/rain_of_fire,if=active_enemies>=6&talent.wreak_havoc.enabled
actions+=/dimensional_rift,if=!equipped.144369|charges>1|((!talent.grimoire_of_service.enabled|recharge_time<cooldown.service_pet.remains)&(!talent.soul_harvest.enabled|recharge_time<cooldown.soul_harvest.remains)&(!talent.grimoire_of_supremacy.enabled|recharge_time<cooldown.summon_doomguard.remains))
actions+=/life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<duration*0.3
actions+=/cataclysm
actions+=/chaos_bolt,if=(cooldown.havoc.remains>12&cooldown.havoc.remains|active_enemies<3|talent.wreak_havoc.enabled&active_enemies<6)
actions+=/shadowburn
actions+=/conflagrate,if=!talent.roaring_blaze.enabled&!buff.backdraft.remains
actions+=/immolate,if=!talent.roaring_blaze.enabled&remains<=duration*0.3
actions+=/incinerate
actions+=/life_tap

head=eyes_of_azjaqir,id=138314,bonus_id=3445
neck=prydaz_xavarics_magnum_opus,id=132444,ilevel=940,enchant_id=5439
shoulders=pauldrons_of_azjaqir,id=138323,bonus_id=3445
back=astromancers_greatcloak,id=140909,bonus_id=3518,enchant_id=5436
chest=robes_of_fluctuating_energy,id=140848,bonus_id=3445
wrists=woven_lasher_tendril_bracers,id=140886,bonus_id=3445
hands=clutch_of_azjaqir,id=138311,bonus_id=3445
waist=manari_skullbuckled_cinch,id=140887,bonus_id=3445
legs=leggings_of_azjaqir,id=138317,bonus_id=3445
feet=outcast_wanderers_footrags,id=140914,bonus_id=3519
finger1=ring_of_the_scoured_clan,id=140897,bonus_id=3445,enchant=binding_of_haste
finger2=ring_of_braided_stems,id=140896,bonus_id=3518,enchant=binding_of_haste
trinket1=whispers_in_the_dark,id=140809,ilevel=905
trinket2=erratic_metronome,id=140792,ilevel=900
main_hand=scepter_of_sargeras,id=128941,ilevel=929,gem_id=140826/140837/140826,relic_id=3519/3518:3518/3519

# Gear Summary
# gear_ilvl=906.27
# gear_stamina=34192
# gear_intellect=38456
# gear_crit_rating=4150
# gear_haste_rating=10427
# gear_mastery_rating=7113
# gear_versatility_rating=2829
# gear_armor=1954
# set_bonus=tier19_2pc=1
# set_bonus=tier19_4pc=1
default_pet=imp

Sephuz : 988429 dps, 579458 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
988429.5 988429.5 0.0 / 0.000% 0.0 / 0.0% 31.3
RPS Out RPS In Primary Resource Waiting APM Active Skill
25818.4 25818.4 Mana 0.00% 50.1 100.0% 100%
Talents
  • 15: Roaring Blaze (Destruction Warlock)
  • 30: Eradication (Destruction Warlock)
  • 60: Soul Harvest
  • 90: Grimoire of Service
  • 100: Wreak Havoc (Destruction Warlock)
  • Talent Calculator
Artifact

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Sephuz 988429
Chaos Bolt 325082 32.9% 58.2 5.02sec 1680897 1099882 Direct 110.8 0 882228 882228 100.0%  

Stats details: chaos_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 58.16 110.82 0.00 0.00 1.5283 0.0000 97765171.90 97765171.90 0.00 1099881.56 1099881.56
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 110.82 100.00% 882227.95 577515 1357630 882488.11 826006 939399 97765172 97765172 0.00
 
 

Action details: chaos_bolt

Static Values
  • id:116858
  • school:chromatic
  • resource:soul_shard
  • range:40.0
  • travel_speed:16.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:2.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:116858
  • name:Chaos Bolt
  • school:chromatic
  • tooltip:
  • description:Unleashes a devastating blast of chaos, causing {$s1=1} Chaos damage. Chaos Bolt always critically strikes and your critical strike chance increases its damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:4.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Conflagrate 106990 10.8% 47.9 6.27sec 670706 639572 Direct 95.3 190266 445611 337111 57.5%  

Stats details: conflagrate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 47.92 95.33 0.00 0.00 1.0487 0.0000 32137220.73 32137220.73 0.00 639572.14 639572.14
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 40.51 42.49% 190265.75 126130 296502 190363.95 165998 210921 7707132 7707132 0.00
crit 54.82 57.51% 445611.31 252261 715282 445728.62 401390 498128 24430089 24430089 0.00
 
 

Action details: conflagrate

Static Values
  • id:17962
  • school:fire
  • resource:chi
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:9.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.roaring_blaze.enabled&(charges=2+set_bonus.tier19_4pc|(charges>=1+set_bonus.tier19_4pc&recharge_time<gcd)|target.time_to_die<24)
Spelldata
  • id:17962
  • name:Conflagrate
  • school:fire
  • tooltip:
  • description:Triggers an explosion on the target, dealing {$s1=1} Fire damage.{$?s196406=false}[ Reduces the cast time of Incinerate and Chaos Bolt by {$117828s1=30}% for {$117828d=10 seconds}.][] |cFFFFFFFFGenerates 1 Soul Shard.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.265510
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Deadly Grace 5346 0.5% 14.2 2.09sec 111269 0 Direct 14.2 92251 184602 111270 20.6%  

Stats details: deadly_grace

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.19 14.19 0.00 0.00 0.0000 0.0000 1578752.08 1578752.08 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 11.27 79.41% 92251.30 81873 98248 92267.40 84212 98248 1039383 1039383 0.00
crit 2.92 20.59% 184602.27 163746 196496 177032.63 0 196496 539369 539369 0.00
 
 

Action details: deadly_grace

Static Values
  • id:188091
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:25.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188091
  • name:Deadly Grace
  • school:arcane
  • tooltip:
  • description:Deal {$s1=63339 to 95008} Arcane damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:63338.72
  • base_dd_max:95008.08
 
Immolate 233034 23.6% 19.8 15.44sec 3542517 3331908 Direct 38.3 131056 261951 199853 52.6%  
Periodic 290.2 140784 281447 214792 52.6% 195.9%

Stats details: immolate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 19.76 38.31 290.25 290.25 1.0633 2.0323 70000056.46 70000056.46 0.00 114586.26 3331908.06
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 18.17 47.44% 131056.23 87508 205670 131056.90 110135 150913 2381936 2381936 0.00
crit 20.14 52.56% 261951.26 175011 411342 261955.92 223210 296316 5275000 5275000 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 137.5 47.39% 140783.77 45 408700 141020.87 118739 165085 19362681 19362681 0.00
crit 152.7 52.61% 281446.99 64 817397 281902.94 238417 334151 42980440 42980440 0.00
 
 

Action details: immolate

Static Values
  • id:348
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:66000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.32
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:remains<=tick_time
Spelldata
  • id:348
  • name:Immolate
  • school:fire
  • tooltip:
  • description:Burns the enemy, causing {$s1=1} Fire damage immediately and an additional $157736o1 Fire damage over {$157736d=18 seconds}. |cFFFFFFFFPeriodic damage has a {$193541s1=15}% chance to generate 1 Soul Shard. Chance doubled on critical strikes.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.332000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.721500
  • base_td:0.00
  • dot_duration:18.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Incinerate 131323 13.3% 78.2 3.67sec 505515 405969 Direct 150.0 218379 436742 263402 20.6%  

Stats details: incinerate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 78.18 150.04 0.00 0.00 1.2452 0.0000 39520294.31 39520294.31 0.00 405969.25 405969.25
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 119.10 79.38% 218379.38 141453 332530 218435.06 204991 232711 26009179 26009179 0.00
crit 30.94 20.62% 436742.34 282907 665041 436867.89 381447 500834 13511115 13511115 0.00
 
 

Action details: incinerate

Static Values
  • id:29722
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:66000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:29722
  • name:Incinerate
  • school:fire
  • tooltip:
  • description:Draws fire toward the enemy, dealing {$s2=0} Fire damage.{$?s29722=true}|!c3[][ Replaces Shadow Bolt.]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.331000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Mark of the Hidden Satyr 8914 0.9% 19.8 15.14sec 135517 0 Direct 19.8 112371 224601 135516 20.6%  

Stats details: mark_of_the_hidden_satyr

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 19.78 19.78 0.00 0.00 0.0000 0.0000 2680715.39 2680715.39 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 15.70 79.38% 112371.30 107063 135251 112390.06 107063 123167 1764412 1764412 0.00
crit 4.08 20.62% 224600.50 214126 270502 220941.75 0 270502 916304 916304 0.00
 
 

Action details: mark_of_the_hidden_satyr

Static Values
  • id:191259
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191259
  • name:Mark of the Hidden Satyr
  • school:fire
  • tooltip:
  • description:Deals fire damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:2.500000
  • spell_power_mod.direct:2.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
pet - imp 42380 / 42380
Firebolt 42380 4.3% 107.6 2.80sec 118360 96211 Direct 106.8 98867 197733 119268 20.6%  

Stats details: firebolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 107.63 106.81 0.00 0.00 1.2302 0.0000 12738906.83 12738906.83 0.00 96210.95 96210.95
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 84.77 79.37% 98866.96 63168 119699 98893.91 96760 101445 8381025 8381025 0.00
crit 22.04 20.63% 197732.71 126337 239399 197796.33 181433 215597 4357882 4357882 0.00
 
 

Action details: firebolt

Static Values
  • id:3110
  • school:fire
  • resource:energy
  • range:40.0
  • travel_speed:16.0000
  • trigger_gcd:0.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.75
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:3110
  • name:Firebolt
  • school:fire
  • tooltip:
  • description:Deals {$s1=1} Fire damage to a target.$?a231795[ Damage increased by {$231795s1=50}% if you have Immolated the target.][] |cFF777777(Right-Click to toggle)|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
pet - service_imp 122612 / 39103
Firebolt 122612 3.9% 48.4 5.60sec 241918 209706 Direct 48.2 201740 403696 243317 20.6%  

Stats details: firebolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 48.43 48.15 0.00 0.00 1.1536 0.0000 11716292.98 11716292.98 0.00 209706.34 209706.34
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 38.24 79.41% 201739.84 126337 239399 201928.30 193283 210702 7714493 7714493 0.00
crit 9.91 20.59% 403696.44 252674 478798 404092.62 336898 478798 4001800 4001800 0.00
 
 

Action details: firebolt

Static Values
  • id:3110
  • school:fire
  • resource:energy
  • range:40.0
  • travel_speed:16.0000
  • trigger_gcd:0.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.75
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:3110
  • name:Firebolt
  • school:fire
  • tooltip:
  • description:Deals {$s1=1} Fire damage to a target.$?a231795[ Damage increased by {$231795s1=50}% if you have Immolated the target.][] |cFF777777(Right-Click to toggle)|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
pet - infernal 116711 / 9885
Immolation 90848 0.8% 1.0 0.00sec 2271282 0 Periodic 46.2 40722 81444 49112 20.6% 8.1%

Stats details: immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 23.12 46.25 0.0000 1.0597 2271282.30 2271282.30 0.00 92690.27 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 36.7 79.40% 40722.39 35222 42266 40722.33 39601 41826 1495286 1495286 0.00
crit 9.5 20.60% 81443.78 70443 84532 81441.45 70443 84532 775996 775996 0.00
 
 

Action details: immolation

Static Values
  • id:19483
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!ticking
Spelldata
  • id:19483
  • name:Immolation
  • school:fire
  • tooltip:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
 

Action details: immolation_tick

Static Values
  • id:20153
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all enemies near the caster.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
melee 25864 0.2% 22.0 1.12sec 29396 26364 Direct 22.0 24357 48734 29396 20.7%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.00 22.00 0.00 0.00 1.1150 0.0000 646615.05 950585.37 31.98 26364.47 26364.47
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 17.45 79.33% 24357.08 21063 25275 24357.37 23169 25275 425018 624817 31.98
crit 4.55 20.67% 48734.50 42125 50550 48408.31 0 50550 221597 325768 31.76
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
pet - doomguard 93918 / 7950
Doom Bolt 93918 0.8% 10.6 2.23sec 220546 101176 Direct 10.6 182655 365288 220566 20.8%  

Stats details: doom_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.65 10.65 0.00 0.00 2.1799 0.0000 2347989.71 2347989.71 0.00 101175.93 101175.93
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 8.44 79.24% 182655.44 176655 211986 182663.46 176655 211986 1540757 1540757 0.00
crit 2.21 20.76% 365288.31 353310 423973 333929.37 0 423973 807233 807233 0.00
 
 

Action details: doom_bolt

Static Values
  • id:85692
  • school:shadow
  • resource:energy
  • range:30.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:35.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:85692
  • name:Doom Bolt
  • school:shadow
  • tooltip:
  • description:Sends a shadowy bolt at the enemy, causing {$s1=1} Shadow damage. Deals {$s2=20}% additional damage to targets below 20% health.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
pet - lord_of_flames_infernal 116697 / 9884
Immolation 90834 0.8% 1.0 0.00sec 2270929 0 Periodic 46.2 40723 81436 49105 20.6% 8.1%

Stats details: immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 23.12 46.25 0.0000 1.0597 2270928.64 2270928.64 0.00 92675.83 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 36.7 79.41% 40723.38 35222 42266 40723.60 39649 41839 1495640 1495640 0.00
crit 9.5 20.59% 81436.18 70443 84532 81424.53 70443 84532 775289 775289 0.00
 
 

Action details: immolation

Static Values
  • id:19483
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!ticking
Spelldata
  • id:19483
  • name:Immolation
  • school:fire
  • tooltip:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
 

Action details: immolation_tick

Static Values
  • id:20153
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all enemies near the caster.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
melee 25863 0.2% 22.0 1.12sec 29396 26364 Direct 22.0 24358 48729 29397 20.7%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.00 22.00 0.00 0.00 1.1150 0.0000 646611.26 950579.80 31.98 26364.32 26364.32
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 17.45 79.33% 24357.79 21063 25275 24357.70 23590 25275 425022 624823 31.98
crit 4.55 20.67% 48729.01 42125 50550 48473.34 0 50550 221589 325757 31.81
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
pet - lord_of_flames_infernal 116797 / 9892
Immolation 90943 0.8% 1.0 0.00sec 2273654 0 Periodic 46.2 40724 81434 49163 20.7% 8.1%

Stats details: immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 23.12 46.25 0.0000 1.0597 2273653.66 2273653.66 0.00 92787.04 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 36.7 79.27% 40723.70 35222 42266 40723.77 39601 41931 1492915 1492915 0.00
crit 9.6 20.73% 81433.78 70443 84532 81429.10 70443 84532 780739 780739 0.00
 
 

Action details: immolation

Static Values
  • id:19483
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!ticking
Spelldata
  • id:19483
  • name:Immolation
  • school:fire
  • tooltip:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
 

Action details: immolation_tick

Static Values
  • id:20153
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all enemies near the caster.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
melee 25855 0.2% 22.0 1.12sec 29386 26356 Direct 22.0 24356 48745 29387 20.6%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.00 22.00 0.00 0.00 1.1150 0.0000 646397.66 950265.79 31.98 26355.61 26355.61
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 17.46 79.37% 24355.75 21063 25275 24355.46 23520 25275 425236 625137 31.98
crit 4.54 20.63% 48744.74 42125 50550 48383.03 0 50550 221162 325129 31.74
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
pet - lord_of_flames_infernal 116736 / 9887
Immolation 90841 0.8% 1.0 0.00sec 2271108 0 Periodic 46.2 40720 81459 49108 20.6% 8.1%

Stats details: immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 23.12 46.25 0.0000 1.0597 2271108.29 2271108.29 0.00 92683.17 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 36.7 79.41% 40720.42 35222 42266 40720.41 39657 42039 1495460 1495460 0.00
crit 9.5 20.59% 81459.04 70443 84532 81454.11 0 84532 775648 775648 0.00
 
 

Action details: immolation

Static Values
  • id:19483
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!ticking
Spelldata
  • id:19483
  • name:Immolation
  • school:fire
  • tooltip:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
 

Action details: immolation_tick

Static Values
  • id:20153
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all enemies near the caster.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
melee 25895 0.2% 22.0 1.12sec 29432 26397 Direct 22.0 24359 48716 29433 20.8%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.00 22.00 0.00 0.00 1.1150 0.0000 647405.40 951747.26 31.98 26396.70 26396.70
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 17.42 79.17% 24359.47 21063 25275 24359.62 23655 25275 424228 623655 31.98
crit 4.58 20.83% 48716.18 42125 50550 48347.04 0 50550 223178 328092 31.73
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
pet - shadowy_tear 122350 / 20709
Shadow Bolt 122350 2.1% 4.4 59.48sec 1412808 0 Periodic 48.0 106718 213786 128775 20.6% 19.8%

Stats details: shadow_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.38 0.00 48.30 48.04 0.0000 1.2342 6186159.63 6186159.63 0.00 103773.73 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 38.1 79.40% 106717.60 57 130050 106536.71 0 130050 4070409 4070409 0.00
crit 9.9 20.60% 213786.36 120 260101 212313.23 0 260101 2115751 2115751 0.00
 
 

Action details: shadow_bolt

Static Values
  • id:196657
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:196657
  • name:Shadow Bolt
  • school:shadow
  • tooltip:
  • description:Sends a shadowy bolt at the enemy, causing {$s1=1} Shadow damage.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:14.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
pet - chaos_tear 140384 / 9686
Chaos Bolt 140384 1.0% 4.4 59.80sec 664688 330864 Direct 4.3 0 669114 669114 100.0%  

Stats details: chaos_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.37 4.34 0.00 0.00 2.0090 0.0000 2903328.88 2903328.88 0.00 330863.69 330863.69
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 4.34 100.00% 669114.12 620865 784329 670160.67 620865 784329 2903329 2903329 0.00
 
 

Action details: chaos_bolt

Static Values
  • id:215279
  • school:chromatic
  • resource:none
  • range:100.0
  • travel_speed:16.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:5.500
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:215279
  • name:Chaos Bolt
  • school:chromatic
  • tooltip:
  • description:Unleashes a devastating blast of chaos, causing {$s1=1} Chaos damage. Chaos Bolt always critically strikes and your critical strike chance increases its damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:5.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
pet - chaos_portal 248165 / 18694
Chaos Barrage 248165 1.9% 4.4 60.16sec 1272800 0 Periodic 151.8 30541 61093 36837 20.6% 7.9%

Stats details: chaos_barrage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.39 0.00 152.54 151.82 0.0000 0.1565 5592426.62 5592426.62 0.00 234267.20 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 120.5 79.39% 30540.98 124 35765 30487.96 0 35765 3681075 3681075 0.00
crit 31.3 20.61% 61092.94 247 71529 60991.82 0 71529 1911352 1911352 0.00
 
 

Action details: chaos_barrage

Static Values
  • id:187394
  • school:magic
  • resource:none
  • range:100.0
  • travel_speed:24.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:187394
  • name:Chaos Barrage
  • school:magic
  • tooltip:
  • description:Deals {$s1=1} Chaos damage.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:5.50
  • base_tick_time:0.25
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Simple Action Stats Execute Interval
Sephuz
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Sephuz
  • harmful:false
  • if_expr:
 
Berserking 2.1 180.50sec

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.07 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=15}%.
  • description:Increases your haste by {$s1=15}% for {$d=10 seconds}.
 
Dimensional Rift 13.1 23.40sec

Stats details: dimensional_rift

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.08 0.00 0.00 0.00 1.0211 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: dimensional_rift

Static Values
  • id:196586
  • school:none
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:45.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:charges=3
Spelldata
  • id:196586
  • name:Dimensional Rift
  • school:chaos
  • tooltip:
  • description:Rips a hole in time and space, opening a portal that damages your target.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Sephuz
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Sephuz
  • harmful:false
  • if_expr:
 
Havoc 14.9 20.92sec

Stats details: havoc

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.89 0.00 0.00 0.00 1.0798 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: havoc

Static Values
  • id:80240
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:88000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies>1&(active_enemies<4|talent.wreak_havoc.enabled&active_enemies<6)&!debuff.havoc.remains
Spelldata
  • id:80240
  • name:Havoc
  • school:shadow
  • tooltip:Spells cast by the Warlock also hit this target.
  • description:Marks a target with Havoc for {$d=8 seconds}, causing your single target spells to also strike the Havoc victim. Limit 1.
 
Life Tap 7.3 31.33sec

Stats details: life_tap

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.34 0.00 0.00 0.00 1.0605 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: life_tap

Static Values
  • id:1454
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.empowered_life_tap.enabled&!buff.empowered_life_tap.remains
Spelldata
  • id:1454
  • name:Life Tap
  • school:shadow
  • tooltip:
  • description:Restores {$s1=30}% of your maximum mana, at the cost of {$s2=10}% of your maximum health.
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Grimoire: Imp (service_imp) 3.7 91.74sec

Stats details: service_imp

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.68 0.00 0.00 0.00 0.9829 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: service_imp

Static Values
  • id:111859
  • school:shadow
  • resource:soul_shard
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:90.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:111859
  • name:Grimoire: Imp
  • school:shadow
  • tooltip:
  • description:Summons an Imp who attacks the target for {$108501s1=25} sec. Imps cast ranged Firebolts and cleanse a hostile magic effect from their master.
 
Soul Harvest 2.9 120.89sec

Stats details: soul_harvest

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.90 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: soul_harvest

Static Values
  • id:196098
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:196098
  • name:Soul Harvest
  • school:shadow
  • tooltip:Damage increased by {$s1=20}%.
  • description:Increases your damage and your pets' damage by {$s1=20}%. Lasts {$d=15 seconds}, increased by {$s2=2} sec for each target afflicted by your {$?s137043=false}[Agony][]{$?s137044=false}[Doom][]{$?s137046=false}[Immolate][], up to a maximum of {$s3=35} sec.
 
Summon Doomguard 1.0 0.00sec

Stats details: summon_doomguard

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 1.0914 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_doomguard

Static Values
  • id:18540
  • school:shadow
  • resource:soul_shard
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.grimoire_of_supremacy.enabled&active_enemies=1&artifact.lord_of_flames.rank=0
Spelldata
  • id:18540
  • name:Summon Doomguard
  • school:shadow
  • tooltip:
  • description:Summons a Doomguard for {$60478d=25 seconds} to assault the target with its Doom Bolts.
 
Summon Imp 1.0 0.00sec

Stats details: summon_imp

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_imp

Static Values
  • id:688
  • school:shadow
  • resource:soul_shard
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!talent.grimoire_of_supremacy.enabled&(!talent.grimoire_of_sacrifice.enabled|buff.demonic_power.down)
Spelldata
  • id:688
  • name:Summon Imp
  • school:shadow
  • tooltip:
  • description:Summons an Imp under your command that casts ranged Firebolts.$?s74434[ |cFFFFFFFFSoulburn:|r |cFF8282FFInstant cast.|r][]
 
Summon Infernal 1.0 0.00sec

Stats details: summon_infernal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.7623 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_infernal

Static Values
  • id:1122
  • school:shadow
  • resource:soul_shard
  • range:30.0
  • travel_speed:1.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.grimoire_of_supremacy.enabled&artifact.lord_of_flames.rank>0
Spelldata
  • id:1122
  • name:Summon Infernal
  • school:shadow
  • tooltip:
  • description:Summons an Infernal from the Twisting Nether, impacting for {$22703s1=0} Fire damage and stunning all enemy targets in the area for {$22703d=2 seconds}. The Infernal will serve you for {$111685d=25 seconds}, dealing strong area-of-effect damage.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Accelerando 20.1 0.0 15.4sec 15.4sec 78.48% 78.48% 1.4(1.4) 19.3

Buff details

  • buff initial source:Sephuz
  • cooldown name:buff_accelerando
  • max_stacks:5
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:734.41

Stack Uptimes

  • accelerando_1:29.75%
  • accelerando_2:24.69%
  • accelerando_3:14.66%
  • accelerando_4:6.51%
  • accelerando_5:2.88%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225719
  • name:Accelerando
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc225125=Your damaging spells have a chance to grant you {$225719s1=528} Haste for {$225719d=12 seconds}, stacking up to 5 times. Stacking does not refresh duration.}
  • max_stacks:5
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Berserking 2.1 0.0 180.5sec 180.5sec 6.87% 8.32% 0.0(0.0) 2.0

Buff details

  • buff initial source:Sephuz
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:10.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • berserking_1:6.87%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=15}%.
  • description:Increases your haste by {$s1=15}% for {$d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.55% 15.49% 0.0(0.0) 1.0

Buff details

  • buff initial source:Sephuz
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:13.55%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Conflagration of Chaos 24.0 0.0 12.4sec 12.4sec 49.19% 46.45% 0.0(0.0) 1.3

Buff details

  • buff initial source:Sephuz
  • cooldown name:buff_conflagration_of_chaos
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:50.00%
  • default_value:-0.00

Stack Uptimes

  • conflagration_of_chaos_1:49.19%

Trigger Attempt Success

  • trigger_pct:50.08%

Spelldata details

  • id:196546
  • name:Conflagration of Chaos
  • tooltip:Your {$?s17877=false}[Shadowburn][Conflagrate] will always critically strike. Critical strike chance will increase the critical strike damage of {$?s17877=false}[Shadowburn][Conflagrate].
  • description:{$@spelldesc219195={$?s17877=false}[Shadowburn][Conflagrate] has a chance to guarantee your next {$?s17877=false}[Shadowburn][Conflagrate] critically strikes, and to increase its damage by your critical strike chance.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Devil's Due 3.5 0.0 69.9sec 69.9sec 8.69% 10.22% 0.0(0.0) 3.2

Buff details

  • buff initial source:Sephuz
  • cooldown name:buff_devils_due
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.18

Stack Uptimes

  • devils_due_1:8.69%

Trigger Attempt Success

  • trigger_pct:99.91%

Spelldata details

  • id:225776
  • name:Devil's Due
  • tooltip:Cast speed slowed by {$s1=7}%.
  • description:{$@spelldesc225142=Your damaging spells have a chance to grant Nefarious Pact, increasing your casting speed by {$225774s1=17}% for {$225774d=12 seconds}. When Nefarious Pact expires, your casting speed is decreased by {$225776s1=7}% for {$225776d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Embrace Chaos 26.0 33.1 11.8sec 5.0sec 59.77% 67.47% 33.1(33.1) 25.4

Buff details

  • buff initial source:Sephuz
  • cooldown name:buff_embrace_chaos
  • max_stacks:1
  • duration:4.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • embrace_chaos_1:59.77%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:212019
  • name:Embrace Chaos
  • tooltip:Chaos Bolt has {$s1=40}% reduced cast time.
  • description:{$@spelldesc212018=Casting Chaos Bolt reduces the cast time of your next Chaos Bolt by {$212019s1=40}% for {$212019d=4 seconds}.}
  • max_stacks:0
  • duration:4.00
  • cooldown:0.00
  • default_chance:0.00%
Lord of Flames 1.0 0.0 0.0sec 0.0sec 97.86% 97.86% 0.0(0.0) 0.0

Buff details

  • buff initial source:Sephuz
  • cooldown name:buff_lord_of_flames
  • max_stacks:1
  • duration:600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • lord_of_flames_1:97.86%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:226802
  • name:Lord of Flames
  • tooltip:Recently activated Lord of Flames.
  • description:{$@spelldesc224103=Once every {$s2=10} minutes, {$?s152107=false}[your Infernal's Meteor Strike][Summon Infernal] will summon {$s3=3} additional Infernals to serve you for {$226804d=25 seconds}.}
  • max_stacks:0
  • duration:600.00
  • cooldown:0.00
  • default_chance:0.00%
Nefarious Pact 3.5 0.0 70.2sec 69.4sec 13.50% 15.05% 0.0(0.0) 3.3

Buff details

  • buff initial source:Sephuz
  • cooldown name:buff_nefarious_pact
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.44

Stack Uptimes

  • nefarious_pact_1:13.50%

Trigger Attempt Success

  • trigger_pct:99.91%

Spelldata details

  • id:225774
  • name:Nefarious Pact
  • tooltip:Cast speed increased by {$s1=17}%.
  • description:{$@spelldesc225142=Your damaging spells have a chance to grant Nefarious Pact, increasing your casting speed by {$225774s1=17}% for {$225774d=12 seconds}. When Nefarious Pact expires, your casting speed is decreased by {$225776s1=7}% for {$225776d=8 seconds}.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of Deadly Grace 1.0 0.0 0.0sec 0.0sec 10.16% 10.16% 0.0(0.0) 1.0

Buff details

  • buff initial source:Sephuz
  • cooldown name:buff_potion_of_deadly_grace
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_deadly_grace_1:10.16%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188027
  • name:Potion of Deadly Grace
  • tooltip:Your attacks have a chance to unleash a bolt of energy at your target.
  • description:Grants your attacks a chance to unleash a bolt of energy at your target. Staying away from enemies for the entire duration of the effect will extend the effect by an additional 5 seconds.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
Potion of Prolonged Power 1.0 0.0 0.0sec 0.0sec 19.64% 19.64% 0.0(0.0) 1.0

Buff details

  • buff initial source:Sephuz
  • cooldown name:buff_potion_of_prolonged_power
  • max_stacks:1
  • duration:60.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:all
  • amount:2500.00

Stack Uptimes

  • potion_of_prolonged_power_1:19.64%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:229206
  • name:Potion of Prolonged Power
  • tooltip:All stats increased by {$s1=2500}.
  • description:Drink to increase all stats by {$s1=2500} for {$d=60 seconds}.
  • max_stacks:0
  • duration:60.00
  • cooldown:1.00
  • default_chance:0.00%
Soul Harvest 2.9 0.0 120.9sec 120.9sec 17.76% 17.76% 0.0(0.0) 2.7

Buff details

  • buff initial source:Sephuz
  • cooldown name:buff_soul_harvest
  • max_stacks:1
  • duration:15.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • soul_harvest_1:17.76%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:196098
  • name:Soul Harvest
  • tooltip:Damage increased by {$s1=20}%.
  • description:Increases your damage and your pets' damage by {$s1=20}%. Lasts {$d=15 seconds}, increased by {$s2=2} sec for each target afflicted by your {$?s137043=false}[Agony][]{$?s137044=false}[Doom][]{$?s137046=false}[Immolate][], up to a maximum of {$s3=35} sec.
  • max_stacks:0
  • duration:15.00
  • cooldown:120.00
  • default_chance:0.00%
Constant Buffs
Well Fed (azshari_salad)

Buff details

  • buff initial source:Sephuz
  • cooldown name:buff_azshari_salad
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:375.00

Stack Uptimes

  • azshari_salad_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225603
  • name:Well Fed
  • tooltip:Haste increased by $w1.
  • description:Increases haste by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Defiled Augmentation

Buff details

  • buff initial source:Sephuz
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Whispered Pact

Buff details

  • buff initial source:Sephuz
  • cooldown name:buff_flask_of_the_whispered_pact
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:1300.00

Stack Uptimes

  • flask_of_the_whispered_pact_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188031
  • name:Flask of the Whispered Pact
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%

Procs

Count Interval
shadowy_tear 4.3 59.2sec
chaos_tear 4.4 59.5sec
chaos_portal 4.4 59.4sec
dimension_ripper 3.9 54.6sec

Resources

Resource Usage Type Count Total Average RPE APR
Sephuz
chaos_bolt Soul Shard 59.2 118.3 2.0 2.0 826251.8
havoc Mana 14.9 1310551.6 88000.0 88000.3 0.0
immolate Mana 19.8 1304158.2 66000.0 66000.0 53.7
incinerate Mana 78.2 5159797.3 66000.0 66000.4 7.7
service_imp Soul Shard 3.7 3.7 1.0 1.0 0.0
summon_doomguard Soul Shard 1.0 1.0 1.0 1.0 0.0
summon_infernal Soul Shard 1.0 1.0 1.0 1.0 0.0
pet - imp
firebolt Energy 107.6 4305.1 40.0 40.0 2959.0
pet - service_imp
firebolt Energy 48.4 1937.3 40.0 40.0 6047.8
pet - doomguard
doom_bolt Energy 10.6 372.6 35.0 35.0 6301.2
Resource Gains Type Count Total Average Overflow
life_tap Mana 7.34 2422331.30 (35.05%) 330000.00 0.00 0.00%
immolate Soul Shard 66.49 65.91 (53.72%) 0.99 0.58 0.88%
conflagrate Soul Shard 47.92 47.86 (39.01%) 1.00 0.05 0.11%
mp5_regen Mana 471.99 4489261.20 (64.95%) 9511.35 89365.14 1.95%
soulsnatcher Soul Shard 8.92 8.92 (7.27%) 1.00 0.00 0.00%
pet - imp
energy_regen Energy 1899.24 4138.76 (100.00%) 2.18 21.61 0.52%
pet - service_imp
energy_regen Energy 437.57 1319.75 (100.00%) 3.02 61.76 4.47%
pet - doomguard
energy_regen Energy 15.34 331.74 (100.00%) 21.62 42.48 11.35%
Resource RPS-Gain RPS-Loss
Health 0.00 7676.30
Mana 22952.66 25818.36
Soul Shard 0.41 0.41
Combat End Resource Mean Min Max
Mana 240114.68 4417.41 514483.96
Soul Shard 1.71 0.00 5.00

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 1.4%

Statistics & Data Analysis

Fight Length
Sample Data Sephuz Fight Length
Count 9999
Mean 301.12
Minimum 221.26
Maximum 379.15
Spread ( max - min ) 157.89
Range [ ( max - min ) / 2 * 100% ] 26.22%
DPS
Sample Data Sephuz Damage Per Second
Count 9999
Mean 988429.49
Minimum 876271.97
Maximum 1143691.47
Spread ( max - min ) 267419.49
Range [ ( max - min ) / 2 * 100% ] 13.53%
Priority Target DPS
Sample Data Sephuz Priority Target Damage Per Second
Count 9999
Mean 579458.15
Minimum 508069.67
Maximum 669070.64
Spread ( max - min ) 161000.98
Range [ ( max - min ) / 2 * 100% ] 13.89%
DPS(e)
Sample Data Sephuz Damage Per Second (Effective)
Count 9999
Mean 988429.49
Minimum 876271.97
Maximum 1143691.47
Spread ( max - min ) 267419.49
Range [ ( max - min ) / 2 * 100% ] 13.53%
Damage
Sample Data Sephuz Damage
Count 9999
Mean 243682210.88
Minimum 170997502.02
Maximum 326297570.05
Spread ( max - min ) 155300068.03
Range [ ( max - min ) / 2 * 100% ] 31.87%
DTPS
Sample Data Sephuz Damage Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Sephuz Healing Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS(e)
Sample Data Sephuz Healing Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Sephuz Heal
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Sephuz Healing Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Sephuz Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
ETMI
Sample Data SephuzTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data Sephuz Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=whispered_pact
1 0.00 food,type=azshari_salad
2 0.00 summon_pet,if=!talent.grimoire_of_supremacy.enabled&(!talent.grimoire_of_sacrifice.enabled|buff.demonic_power.down)
3 0.00 summon_infernal,if=talent.grimoire_of_supremacy.enabled&artifact.lord_of_flames.rank>0
4 0.00 summon_infernal,if=talent.grimoire_of_supremacy.enabled&active_enemies>1
5 0.00 summon_doomguard,if=talent.grimoire_of_supremacy.enabled&active_enemies=1&artifact.lord_of_flames.rank=0
6 0.00 augmentation,type=defiled
7 0.00 snapshot_stats
8 0.00 grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
9 0.00 life_tap,if=talent.empowered_life_tap.enabled&!buff.empowered_life_tap.remains
A 0.00 potion,name=prolonged_power
B 0.00 chaos_bolt
Default action list Executed every time the actor is available.
# count action,conditions
C 14.89 havoc,target=2,if=active_enemies>1&(active_enemies<4|talent.wreak_havoc.enabled&active_enemies<6)&!debuff.havoc.remains
D 1.00 dimensional_rift,if=charges=3
E 10.27 immolate,if=remains<=tick_time
F 0.60 immolate,cycle_targets=1,if=active_enemies>1&remains<=tick_time&(!talent.roaring_blaze.enabled|(!debuff.roaring_blaze.remains&action.conflagrate.charges<2))
G 8.94 immolate,if=talent.roaring_blaze.enabled&remains<=duration&!debuff.roaring_blaze.remains&target.time_to_die>10&(action.conflagrate.charges=2+set_bonus.tier19_4pc|(action.conflagrate.charges>=1+set_bonus.tier19_4pc&action.conflagrate.recharge_time<cast_time+gcd)|target.time_to_die<24)
H 2.08 berserking
0.00 blood_fury
0.00 arcane_torrent
I 1.00 potion,name=deadly_grace,if=(buff.soul_harvest.remains|trinket.proc.any.react|target.time_to_die<=45)
0.00 shadowburn,if=buff.conflagration_of_chaos.remains<=action.chaos_bolt.cast_time
0.00 shadowburn,if=(charges=1&recharge_time<action.chaos_bolt.cast_time|charges=2)&soul_shard<5
J 13.80 conflagrate,if=talent.roaring_blaze.enabled&(charges=2+set_bonus.tier19_4pc|(charges>=1+set_bonus.tier19_4pc&recharge_time<gcd)|target.time_to_die<24)
K 34.12 conflagrate,if=talent.roaring_blaze.enabled&debuff.roaring_blaze.stack>0&dot.immolate.remains>dot.immolate.duration*0.3&(active_enemies=1|soul_shard<3)&soul_shard<5
0.00 conflagrate,if=!talent.roaring_blaze.enabled&!buff.backdraft.remains&buff.conflagration_of_chaos.remains<=action.chaos_bolt.cast_time
0.00 conflagrate,if=!talent.roaring_blaze.enabled&!buff.backdraft.remains&(charges=1&recharge_time<action.chaos_bolt.cast_time|charges=2)&soul_shard<5
0.00 life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<=gcd
0.00 dimensional_rift,if=equipped.144369&!buff.lessons_of_spacetime.remains&((!talent.grimoire_of_supremacy.enabled&!cooldown.summon_doomguard.remains)|(talent.grimoire_of_service.enabled&!cooldown.service_pet.remains)|(talent.soul_harvest.enabled&!cooldown.soul_harvest.remains))
L 3.68 service_pet
M 1.00 summon_infernal,if=artifact.lord_of_flames.rank>0&!buff.lord_of_flames.remains
N 1.00 summon_doomguard,if=!talent.grimoire_of_supremacy.enabled&spell_targets.infernal_awakening<=2&(target.time_to_die>180|target.health.pct<=20|target.time_to_die<30)
0.00 summon_infernal,if=!talent.grimoire_of_supremacy.enabled&spell_targets.infernal_awakening>2
0.00 summon_doomguard,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal=1&artifact.lord_of_flames.rank>0&buff.lord_of_flames.remains&!pet.doomguard.active
0.00 summon_doomguard,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal=1&equipped.132379&!cooldown.sindorei_spite_icd.remains
0.00 summon_infernal,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal>1&equipped.132379&!cooldown.sindorei_spite_icd.remains
O 2.90 soul_harvest
0.00 channel_demonfire,if=dot.immolate.remains>cast_time
0.00 havoc,if=active_enemies=1&talent.wreak_havoc.enabled&equipped.132375&!debuff.havoc.remains
0.00 rain_of_fire,if=active_enemies>=3&cooldown.havoc.remains<=12&!talent.wreak_havoc.enabled
0.00 rain_of_fire,if=active_enemies>=6&talent.wreak_havoc.enabled
P 12.08 dimensional_rift,if=!equipped.144369|charges>1|((!talent.grimoire_of_service.enabled|recharge_time<cooldown.service_pet.remains)&(!talent.soul_harvest.enabled|recharge_time<cooldown.soul_harvest.remains)&(!talent.grimoire_of_supremacy.enabled|recharge_time<cooldown.summon_doomguard.remains))
0.00 life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<duration*0.3
0.00 cataclysm
Q 58.48 chaos_bolt,if=(cooldown.havoc.remains>12&cooldown.havoc.remains|active_enemies<3|talent.wreak_havoc.enabled&active_enemies<6)
0.00 shadowburn
0.00 conflagrate,if=!talent.roaring_blaze.enabled&!buff.backdraft.remains
0.00 immolate,if=!talent.roaring_blaze.enabled&remains<=duration*0.3
R 78.50 incinerate
S 7.34 life_tap

Sample Sequence

0126ABCDEGHJKLKMOPKPQQRKQRRRKRCQRRREPQQRRPGJQQKQKQRKCQQQRKPQRRRRERQRRCPQRGJQKKQKQRQRCKRQRESQPQRLRGJKCQKQKQRQQKQRRRECFRSRROIQRRRRGJKQKPQCQKQRRKQRSRRRRERSQCRRGJKQKQQKRPRPKCHQLRPERRRRSRRGJQCKKQKQRRKQRRRERSCPRRRQGJKNKQQKQRCRORRKQRPQSREQRQRRCGJQKPQJJLQQRJRRCQEJQRRJQSRR

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask Sephuz 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 1 food Sephuz 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 2 summon_imp Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 6 augmentation Sephuz 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat A potion Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard potion_of_prolonged_power
0:00.000 precombat B chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard embrace_chaos, accelerando, potion_of_prolonged_power
0:00.000 default C havoc enemy2 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard embrace_chaos, accelerando, potion_of_prolonged_power
0:01.156 default D dimensional_rift Fluffy_Pillow 1033514.7/1100000: 94% mana | 1.0/5: 20% soul_shard bloodlust, embrace_chaos, accelerando, potion_of_prolonged_power
0:02.047 default E immolate Fluffy_Pillow 1050097.4/1100000: 95% mana | 1.0/5: 20% soul_shard bloodlust, embrace_chaos, accelerando, potion_of_prolonged_power
0:02.938 default G immolate Fluffy_Pillow 1000680.2/1100000: 91% mana | 1.0/5: 20% soul_shard bloodlust, embrace_chaos, accelerando, potion_of_prolonged_power
0:03.829 default H berserking Fluffy_Pillow 951262.9/1100000: 86% mana | 1.0/5: 20% soul_shard bloodlust, embrace_chaos, accelerando, potion_of_prolonged_power
0:03.829 default J conflagrate Fluffy_Pillow 951262.9/1100000: 86% mana | 1.0/5: 20% soul_shard bloodlust, berserking, embrace_chaos, accelerando, potion_of_prolonged_power
0:04.604 default K conflagrate Fluffy_Pillow 967850.2/1100000: 88% mana | 2.0/5: 40% soul_shard bloodlust, berserking, conflagration_of_chaos, accelerando, potion_of_prolonged_power
0:05.376 default L service_imp Fluffy_Pillow 984373.4/1100000: 89% mana | 3.0/5: 60% soul_shard bloodlust, berserking, accelerando, potion_of_prolonged_power
0:06.151 default K conflagrate Fluffy_Pillow 1000960.8/1100000: 91% mana | 2.0/5: 40% soul_shard bloodlust, berserking, accelerando, potion_of_prolonged_power
0:06.925 default M summon_infernal Fluffy_Pillow 1017776.2/1100000: 93% mana | 3.0/5: 60% soul_shard bloodlust, berserking, accelerando(2), potion_of_prolonged_power
0:07.688 default O soul_harvest Fluffy_Pillow 1034598.3/1100000: 94% mana | 2.0/5: 40% soul_shard bloodlust, berserking, lord_of_flames, accelerando(3), potion_of_prolonged_power
0:07.688 default P dimensional_rift Fluffy_Pillow 1034598.3/1100000: 94% mana | 2.0/5: 40% soul_shard bloodlust, berserking, soul_harvest, lord_of_flames, accelerando(3), potion_of_prolonged_power
0:08.444 default K conflagrate Fluffy_Pillow 1051266.0/1100000: 96% mana | 2.0/5: 40% soul_shard bloodlust, berserking, soul_harvest, lord_of_flames, accelerando(3), potion_of_prolonged_power
0:09.198 default P dimensional_rift Fluffy_Pillow 1067889.7/1100000: 97% mana | 3.0/5: 60% soul_shard bloodlust, berserking, soul_harvest, lord_of_flames, accelerando(3), potion_of_prolonged_power
0:09.954 default Q chaos_bolt Fluffy_Pillow 1084557.4/1100000: 99% mana | 4.0/5: 80% soul_shard bloodlust, berserking, soul_harvest, lord_of_flames, accelerando(3), potion_of_prolonged_power
0:11.455 default Q chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 2.0/5: 40% soul_shard bloodlust, berserking, soul_harvest, lord_of_flames, embrace_chaos, accelerando(3), potion_of_prolonged_power
0:12.358 default R incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard bloodlust, berserking, soul_harvest, lord_of_flames, embrace_chaos, potion_of_prolonged_power
0:13.301 default K conflagrate Fluffy_Pillow 1034084.3/1100000: 94% mana | 1.0/5: 20% soul_shard bloodlust, berserking, soul_harvest, lord_of_flames, embrace_chaos, potion_of_prolonged_power
0:14.089 default Q chaos_bolt Fluffy_Pillow 1049981.4/1100000: 95% mana | 2.0/5: 40% soul_shard bloodlust, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, potion_of_prolonged_power
0:15.173 default R incinerate Fluffy_Pillow 1069852.7/1100000: 97% mana | 0.0/5: 0% soul_shard bloodlust, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, potion_of_prolonged_power
0:16.257 default R incinerate Fluffy_Pillow 1023724.0/1100000: 93% mana | 0.0/5: 0% soul_shard bloodlust, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, potion_of_prolonged_power
0:17.342 default R incinerate Fluffy_Pillow 977658.1/1100000: 89% mana | 0.0/5: 0% soul_shard bloodlust, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando, potion_of_prolonged_power
0:18.411 default K conflagrate Fluffy_Pillow 931553.6/1100000: 85% mana | 0.0/5: 0% soul_shard bloodlust, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando, potion_of_prolonged_power
0:19.302 default R incinerate Fluffy_Pillow 948136.3/1100000: 86% mana | 1.0/5: 20% soul_shard bloodlust, soul_harvest, lord_of_flames, conflagration_of_chaos, accelerando, potion_of_prolonged_power
0:20.368 default C havoc enemy2 901976.1/1100000: 82% mana | 1.0/5: 20% soul_shard bloodlust, soul_harvest, lord_of_flames, conflagration_of_chaos, accelerando, potion_of_prolonged_power
0:21.257 default Q chaos_bolt Fluffy_Pillow 830521.5/1100000: 76% mana | 2.0/5: 40% soul_shard bloodlust, soul_harvest, lord_of_flames, conflagration_of_chaos, accelerando, potion_of_prolonged_power
0:23.035 default R incinerate Fluffy_Pillow 863761.9/1100000: 79% mana | 0.0/5: 0% soul_shard bloodlust, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2), potion_of_prolonged_power
0:24.088 default R incinerate Fluffy_Pillow 817656.2/1100000: 74% mana | 0.0/5: 0% soul_shard bloodlust, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3), potion_of_prolonged_power
0:25.124 default R incinerate Fluffy_Pillow 771517.9/1100000: 70% mana | 1.0/5: 20% soul_shard bloodlust, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3), potion_of_prolonged_power
0:26.160 default E immolate Fluffy_Pillow 725379.6/1100000: 66% mana | 2.0/5: 40% soul_shard bloodlust, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3), potion_of_prolonged_power
0:27.025 default P dimensional_rift Fluffy_Pillow 675963.0/1100000: 61% mana | 2.0/5: 40% soul_shard bloodlust, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3), potion_of_prolonged_power
0:27.889 default Q chaos_bolt Fluffy_Pillow 692527.2/1100000: 63% mana | 2.0/5: 40% soul_shard bloodlust, lord_of_flames, conflagration_of_chaos, accelerando(3), potion_of_prolonged_power
0:29.613 default Q chaos_bolt Fluffy_Pillow 725284.4/1100000: 66% mana | 2.0/5: 40% soul_shard bloodlust, lord_of_flames, conflagration_of_chaos, embrace_chaos, potion_of_prolonged_power
0:30.697 default R incinerate Fluffy_Pillow 745171.4/1100000: 68% mana | 1.0/5: 20% soul_shard bloodlust, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando, potion_of_prolonged_power
0:31.453 default R incinerate Fluffy_Pillow 693241.6/1100000: 63% mana | 1.0/5: 20% soul_shard bloodlust, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando, potion_of_prolonged_power
0:32.205 default P dimensional_rift Fluffy_Pillow 641237.3/1100000: 58% mana | 2.0/5: 40% soul_shard bloodlust, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando, potion_of_prolonged_power
0:32.958 default G immolate Fluffy_Pillow 655251.7/1100000: 60% mana | 2.0/5: 40% soul_shard bloodlust, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando, potion_of_prolonged_power
0:33.712 default J conflagrate Fluffy_Pillow 603284.6/1100000: 55% mana | 4.0/5: 80% soul_shard bloodlust, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando, potion_of_prolonged_power
0:34.465 default Q chaos_bolt Fluffy_Pillow 617299.0/1100000: 56% mana | 5.0/5: 100% soul_shard bloodlust, lord_of_flames, embrace_chaos, nefarious_pact, accelerando, potion_of_prolonged_power
0:35.220 default Q chaos_bolt Fluffy_Pillow 631350.5/1100000: 57% mana | 3.0/5: 60% soul_shard bloodlust, lord_of_flames, embrace_chaos, nefarious_pact, accelerando, potion_of_prolonged_power
0:35.976 default K conflagrate Fluffy_Pillow 645420.7/1100000: 59% mana | 2.0/5: 40% soul_shard bloodlust, lord_of_flames, embrace_chaos, nefarious_pact, accelerando, potion_of_prolonged_power
0:36.730 default Q chaos_bolt Fluffy_Pillow 659453.7/1100000: 60% mana | 3.0/5: 60% soul_shard bloodlust, lord_of_flames, embrace_chaos, nefarious_pact, accelerando, potion_of_prolonged_power
0:37.485 default K conflagrate Fluffy_Pillow 673505.3/1100000: 61% mana | 2.0/5: 40% soul_shard bloodlust, lord_of_flames, embrace_chaos, nefarious_pact, accelerando, potion_of_prolonged_power
0:38.240 default Q chaos_bolt Fluffy_Pillow 687556.8/1100000: 63% mana | 3.0/5: 60% soul_shard bloodlust, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando, potion_of_prolonged_power
0:38.995 default R incinerate Fluffy_Pillow 701724.4/1100000: 64% mana | 1.0/5: 20% soul_shard bloodlust, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(2), potion_of_prolonged_power
0:39.750 default K conflagrate Fluffy_Pillow 649987.6/1100000: 59% mana | 2.0/5: 40% soul_shard bloodlust, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(2), potion_of_prolonged_power
0:40.504 default C havoc enemy2 664231.9/1100000: 60% mana | 4.0/5: 80% soul_shard bloodlust, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(2), potion_of_prolonged_power
0:41.260 default Q chaos_bolt Fluffy_Pillow 587218.1/1100000: 53% mana | 5.0/5: 100% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(2), potion_of_prolonged_power
0:42.207 default Q chaos_bolt Fluffy_Pillow 600980.0/1100000: 55% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(2), potion_of_prolonged_power
0:43.156 default Q chaos_bolt Fluffy_Pillow 614548.9/1100000: 56% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due, potion_of_prolonged_power
0:44.815 default R incinerate Fluffy_Pillow 637942.7/1100000: 58% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due, potion_of_prolonged_power
0:46.474 default K conflagrate Fluffy_Pillow 595336.5/1100000: 54% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due, potion_of_prolonged_power
0:47.857 default P dimensional_rift Fluffy_Pillow 614838.3/1100000: 56% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, devils_due, potion_of_prolonged_power
0:49.238 default Q chaos_bolt Fluffy_Pillow 634412.9/1100000: 58% mana | 2.0/5: 40% soul_shard lord_of_flames, devils_due, accelerando, potion_of_prolonged_power
0:51.958 default R incinerate Fluffy_Pillow 673353.6/1100000: 61% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos, nefarious_pact, accelerando, potion_of_prolonged_power
0:52.921 default R incinerate Fluffy_Pillow 621140.3/1100000: 56% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos, nefarious_pact, accelerando, potion_of_prolonged_power
0:53.883 default R incinerate Fluffy_Pillow 568912.7/1100000: 52% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos, nefarious_pact, accelerando, potion_of_prolonged_power
0:54.846 default R incinerate Fluffy_Pillow 516700.5/1100000: 47% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos, nefarious_pact, accelerando(2), potion_of_prolonged_power
0:55.795 default E immolate Fluffy_Pillow 464491.4/1100000: 42% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, nefarious_pact, accelerando(2), potion_of_prolonged_power
0:56.586 default R incinerate Fluffy_Pillow 409986.3/1100000: 37% mana | 1.0/5: 20% soul_shard lord_of_flames, nefarious_pact, accelerando(2), potion_of_prolonged_power
0:57.536 default Q chaos_bolt Fluffy_Pillow 357913.1/1100000: 33% mana | 2.0/5: 40% soul_shard lord_of_flames, nefarious_pact, accelerando(3), potion_of_prolonged_power
0:59.090 default R incinerate Fluffy_Pillow 380830.5/1100000: 35% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos, nefarious_pact, accelerando(3)
1:00.024 default R incinerate Fluffy_Pillow 328605.3/1100000: 30% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos, nefarious_pact, accelerando(4)
1:00.946 default C havoc enemy2 276248.6/1100000: 25% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, nefarious_pact
1:01.761 default P dimensional_rift Fluffy_Pillow 199741.0/1100000: 18% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, nefarious_pact
1:02.575 default Q chaos_bolt Fluffy_Pillow 211219.3/1100000: 19% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, nefarious_pact
1:03.554 default R incinerate Fluffy_Pillow 225024.3/1100000: 20% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, devils_due
1:05.212 default G immolate Fluffy_Pillow 182483.7/1100000: 17% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, devils_due, accelerando
1:06.575 default J conflagrate Fluffy_Pillow 135997.0/1100000: 12% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, devils_due, accelerando
1:07.937 default Q chaos_bolt Fluffy_Pillow 155495.9/1100000: 14% mana | 3.0/5: 60% soul_shard lord_of_flames, devils_due, accelerando
1:10.657 default K conflagrate Fluffy_Pillow 194514.2/1100000: 18% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, devils_due, accelerando(2)
1:11.999 default K conflagrate Fluffy_Pillow 214016.2/1100000: 19% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
1:13.139 default Q chaos_bolt Fluffy_Pillow 230614.8/1100000: 21% mana | 4.0/5: 80% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
1:14.484 default K conflagrate Fluffy_Pillow 250450.0/1100000: 23% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
1:15.606 default Q chaos_bolt Fluffy_Pillow 267073.2/1100000: 24% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(4)
1:16.935 default R incinerate Fluffy_Pillow 286878.8/1100000: 26% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
1:18.343 default Q chaos_bolt Fluffy_Pillow 240733.2/1100000: 22% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
1:19.753 default R incinerate Fluffy_Pillow 260617.1/1100000: 24% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
1:21.143 default C havoc enemy2 214516.9/1100000: 20% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
1:22.299 default K conflagrate Fluffy_Pillow 143066.7/1100000: 13% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
1:23.457 default R incinerate Fluffy_Pillow 159894.8/1100000: 15% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
1:24.825 default Q chaos_bolt Fluffy_Pillow 113862.9/1100000: 10% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, accelerando(3)
1:27.066 default R incinerate Fluffy_Pillow 146911.6/1100000: 13% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
1:28.413 default E immolate Fluffy_Pillow 100776.3/1100000: 9% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
1:29.536 default S life_tap Fluffy_Pillow 51337.5/1100000: 5% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
1:30.659 default Q chaos_bolt Fluffy_Pillow 397898.8/1100000: 36% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
1:32.005 default P dimensional_rift Fluffy_Pillow 417582.8/1100000: 38% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
1:33.161 default Q chaos_bolt Fluffy_Pillow 434132.6/1100000: 39% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
1:34.550 default R incinerate Fluffy_Pillow 454018.1/1100000: 41% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
1:35.937 default L service_imp Fluffy_Pillow 407875.0/1100000: 37% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
1:37.094 default R incinerate Fluffy_Pillow 424439.1/1100000: 39% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
1:38.482 default G immolate Fluffy_Pillow 378311.4/1100000: 34% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
1:39.622 default J conflagrate Fluffy_Pillow 328877.9/1100000: 30% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, accelerando(2)
1:40.763 default K conflagrate Fluffy_Pillow 345459.0/1100000: 31% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, accelerando(2)
1:41.904 default C havoc enemy2 362040.0/1100000: 33% mana | 3.0/5: 60% soul_shard lord_of_flames, accelerando(2)
1:43.043 default Q chaos_bolt Fluffy_Pillow 290592.0/1100000: 26% mana | 3.0/5: 60% soul_shard lord_of_flames, accelerando(2)
1:45.317 default K conflagrate Fluffy_Pillow 323144.6/1100000: 29% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando
1:46.474 default Q chaos_bolt Fluffy_Pillow 339708.7/1100000: 31% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
1:47.862 default K conflagrate Fluffy_Pillow 359579.9/1100000: 33% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
1:49.017 default Q chaos_bolt Fluffy_Pillow 376115.4/1100000: 34% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
1:50.403 default R incinerate Fluffy_Pillow 395958.6/1100000: 36% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
1:51.769 default Q chaos_bolt Fluffy_Pillow 349810.2/1100000: 32% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
1:53.117 default Q chaos_bolt Fluffy_Pillow 369689.6/1100000: 34% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
1:54.464 default K conflagrate Fluffy_Pillow 389554.3/1100000: 35% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
1:55.587 default Q chaos_bolt Fluffy_Pillow 406115.5/1100000: 37% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando(3)
1:56.936 default R incinerate Fluffy_Pillow 426009.7/1100000: 39% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos, accelerando(3)
1:58.282 default R incinerate Fluffy_Pillow 379234.3/1100000: 34% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos, accelerando
1:59.671 default R incinerate Fluffy_Pillow 333151.7/1100000: 30% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos, accelerando(2)
2:01.039 default E immolate Fluffy_Pillow 287031.5/1100000: 26% mana | 0.0/5: 0% soul_shard lord_of_flames, accelerando(2)
2:02.179 default C havoc enemy2 237598.0/1100000: 22% mana | 0.0/5: 0% soul_shard lord_of_flames, accelerando(2)
2:03.318 default F immolate enemy2 166150.0/1100000: 15% mana | 0.0/5: 0% soul_shard lord_of_flames, nefarious_pact, accelerando(2)
2:04.109 default R incinerate Fluffy_Pillow 111645.9/1100000: 10% mana | 0.0/5: 0% soul_shard lord_of_flames, nefarious_pact, accelerando(3)
2:05.044 default S life_tap Fluffy_Pillow 59434.7/1100000: 5% mana | 0.0/5: 0% soul_shard lord_of_flames, nefarious_pact, accelerando(3)
2:05.822 default R incinerate Fluffy_Pillow 400908.1/1100000: 36% mana | 0.0/5: 0% soul_shard lord_of_flames, nefarious_pact, accelerando(3)
2:06.757 default R incinerate Fluffy_Pillow 348696.8/1100000: 32% mana | 1.0/5: 20% soul_shard lord_of_flames, nefarious_pact, accelerando(3)
2:07.692 default O soul_harvest Fluffy_Pillow 296485.6/1100000: 27% mana | 2.0/5: 40% soul_shard lord_of_flames, nefarious_pact, accelerando(3)
2:07.692 default I potion Fluffy_Pillow 296485.6/1100000: 27% mana | 2.0/5: 40% soul_shard soul_harvest, lord_of_flames, nefarious_pact, accelerando(3)
2:07.692 default Q chaos_bolt Fluffy_Pillow 296485.6/1100000: 27% mana | 2.0/5: 40% soul_shard soul_harvest, lord_of_flames, nefarious_pact, accelerando(3), potion_of_deadly_grace
2:09.248 default R incinerate Fluffy_Pillow 319432.4/1100000: 29% mana | 0.0/5: 0% soul_shard soul_harvest, lord_of_flames, embrace_chaos, nefarious_pact, accelerando(3), potion_of_deadly_grace
2:10.182 default R incinerate Fluffy_Pillow 267206.5/1100000: 24% mana | 0.0/5: 0% soul_shard soul_harvest, lord_of_flames, embrace_chaos, nefarious_pact, accelerando(3), potion_of_deadly_grace
2:11.119 default R incinerate Fluffy_Pillow 214481.2/1100000: 19% mana | 0.0/5: 0% soul_shard soul_harvest, lord_of_flames, embrace_chaos, nefarious_pact, potion_of_deadly_grace
2:12.096 default R incinerate Fluffy_Pillow 162258.0/1100000: 15% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, embrace_chaos, nefarious_pact, potion_of_deadly_grace
2:13.073 default G immolate Fluffy_Pillow 110177.4/1100000: 10% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, embrace_chaos, nefarious_pact, accelerando, potion_of_deadly_grace
2:13.876 default J conflagrate Fluffy_Pillow 55673.5/1100000: 5% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, nefarious_pact, accelerando, potion_of_deadly_grace
2:14.679 default K conflagrate Fluffy_Pillow 67169.5/1100000: 6% mana | 2.0/5: 40% soul_shard soul_harvest, lord_of_flames, nefarious_pact, accelerando, potion_of_deadly_grace
2:15.481 default Q chaos_bolt Fluffy_Pillow 78719.2/1100000: 7% mana | 4.0/5: 80% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, devils_due, accelerando(2), potion_of_deadly_grace
2:18.162 default K conflagrate Fluffy_Pillow 117679.6/1100000: 11% mana | 2.0/5: 40% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due, accelerando(2), potion_of_deadly_grace
2:19.503 default P dimensional_rift Fluffy_Pillow 137167.0/1100000: 12% mana | 4.0/5: 80% soul_shard soul_harvest, lord_of_flames, embrace_chaos, devils_due, accelerando(2), potion_of_deadly_grace
2:20.844 default Q chaos_bolt Fluffy_Pillow 156654.5/1100000: 14% mana | 4.0/5: 80% soul_shard soul_harvest, lord_of_flames, embrace_chaos, devils_due, accelerando(2), potion_of_deadly_grace
2:22.453 default C havoc enemy2 180036.5/1100000: 16% mana | 2.0/5: 40% soul_shard soul_harvest, lord_of_flames, embrace_chaos, devils_due, accelerando(2), potion_of_deadly_grace
2:23.794 default Q chaos_bolt Fluffy_Pillow 111645.0/1100000: 10% mana | 3.0/5: 60% soul_shard soul_harvest, lord_of_flames, embrace_chaos, nefarious_pact, accelerando(3), potion_of_deadly_grace
2:24.728 default K conflagrate Fluffy_Pillow 125214.1/1100000: 11% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, embrace_chaos, nefarious_pact, potion_of_deadly_grace
2:25.542 default Q chaos_bolt Fluffy_Pillow 136692.4/1100000: 12% mana | 2.0/5: 40% soul_shard soul_harvest, lord_of_flames, embrace_chaos, nefarious_pact, potion_of_deadly_grace
2:26.517 default R incinerate Fluffy_Pillow 150441.0/1100000: 14% mana | 0.0/5: 0% soul_shard soul_harvest, lord_of_flames, embrace_chaos, nefarious_pact, potion_of_deadly_grace
2:27.494 default R incinerate Fluffy_Pillow 98297.7/1100000: 9% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, nefarious_pact, accelerando, potion_of_deadly_grace
2:28.456 default K conflagrate Fluffy_Pillow 46070.1/1100000: 4% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, nefarious_pact, accelerando, potion_of_deadly_grace
2:29.258 default Q chaos_bolt Fluffy_Pillow 57551.9/1100000: 5% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando, potion_of_deadly_grace
2:30.219 default R incinerate Fluffy_Pillow 71310.0/1100000: 6% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando, potion_of_deadly_grace
2:31.183 default S life_tap Fluffy_Pillow 19111.0/1100000: 2% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando, potion_of_deadly_grace
2:31.985 default R incinerate Fluffy_Pillow 360592.8/1100000: 33% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando, potion_of_deadly_grace
2:32.947 default R incinerate Fluffy_Pillow 308365.2/1100000: 28% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando, potion_of_deadly_grace
2:33.910 default R incinerate Fluffy_Pillow 256151.9/1100000: 23% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando, potion_of_deadly_grace
2:34.871 default R incinerate Fluffy_Pillow 203910.6/1100000: 19% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, nefarious_pact, accelerando(2), potion_of_deadly_grace
2:35.820 default E immolate Fluffy_Pillow 151701.5/1100000: 14% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, devils_due, accelerando(2), potion_of_deadly_grace
2:37.160 default R incinerate Fluffy_Pillow 105174.4/1100000: 10% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, devils_due, accelerando(2), potion_of_deadly_grace
2:38.771 default S life_tap Fluffy_Pillow 62585.5/1100000: 6% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, devils_due, accelerando(2)
2:40.113 default Q chaos_bolt Fluffy_Pillow 411696.9/1100000: 37% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, devils_due, accelerando
2:42.834 default C havoc enemy2 450652.9/1100000: 41% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due, accelerando(2)
2:44.174 default R incinerate Fluffy_Pillow 382125.9/1100000: 35% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
2:45.541 default R incinerate Fluffy_Pillow 335991.1/1100000: 31% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
2:46.907 default G immolate Fluffy_Pillow 289842.8/1100000: 26% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, accelerando(3)
2:48.029 default J conflagrate Fluffy_Pillow 240472.3/1100000: 22% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, accelerando(5)
2:49.120 default K conflagrate Fluffy_Pillow 257031.7/1100000: 23% mana | 2.0/5: 40% soul_shard lord_of_flames, accelerando(5)
2:50.213 default Q chaos_bolt Fluffy_Pillow 273621.5/1100000: 25% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, accelerando(5)
2:52.393 default K conflagrate Fluffy_Pillow 306228.6/1100000: 28% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
2:53.567 default Q chaos_bolt Fluffy_Pillow 322783.3/1100000: 29% mana | 3.0/5: 60% soul_shard lord_of_flames, embrace_chaos
2:54.975 default Q chaos_bolt Fluffy_Pillow 342761.7/1100000: 31% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando
2:56.363 default K conflagrate Fluffy_Pillow 362632.9/1100000: 33% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos, accelerando
2:57.519 default R incinerate Fluffy_Pillow 379182.7/1100000: 34% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
2:58.906 default P dimensional_rift Fluffy_Pillow 333040.5/1100000: 30% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
3:00.045 default R incinerate Fluffy_Pillow 349592.5/1100000: 32% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
3:01.413 default P dimensional_rift Fluffy_Pillow 303472.3/1100000: 28% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, accelerando(2)
3:02.553 default K conflagrate Fluffy_Pillow 320038.8/1100000: 29% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, accelerando(2)
3:03.694 default C havoc enemy2 336865.5/1100000: 31% mana | 3.0/5: 60% soul_shard lord_of_flames, accelerando(3)
3:04.818 default H berserking Fluffy_Pillow 265441.5/1100000: 24% mana | 3.0/5: 60% soul_shard lord_of_flames, accelerando(3)
3:04.818 default Q chaos_bolt Fluffy_Pillow 265441.5/1100000: 24% mana | 3.0/5: 60% soul_shard berserking, lord_of_flames, accelerando(3)
3:06.768 default L service_imp Fluffy_Pillow 298239.4/1100000: 27% mana | 2.0/5: 40% soul_shard berserking, lord_of_flames, embrace_chaos, accelerando
3:07.775 default R incinerate Fluffy_Pillow 314827.2/1100000: 29% mana | 1.0/5: 20% soul_shard berserking, lord_of_flames, embrace_chaos, accelerando(2)
3:08.963 default P dimensional_rift Fluffy_Pillow 268680.9/1100000: 24% mana | 1.0/5: 20% soul_shard berserking, lord_of_flames, embrace_chaos, accelerando(2)
3:09.955 default E immolate Fluffy_Pillow 285259.0/1100000: 26% mana | 1.0/5: 20% soul_shard berserking, lord_of_flames, embrace_chaos, accelerando(2)
3:10.945 default R incinerate Fluffy_Pillow 235803.7/1100000: 21% mana | 1.0/5: 20% soul_shard berserking, lord_of_flames, accelerando(2)
3:12.132 default R incinerate Fluffy_Pillow 189641.4/1100000: 17% mana | 1.0/5: 20% soul_shard berserking, lord_of_flames, accelerando(3)
3:13.303 default R incinerate Fluffy_Pillow 143500.9/1100000: 13% mana | 1.0/5: 20% soul_shard berserking, lord_of_flames, accelerando(3)
3:14.474 default R incinerate Fluffy_Pillow 97360.4/1100000: 9% mana | 1.0/5: 20% soul_shard berserking, lord_of_flames, accelerando(3)
3:15.647 default S life_tap Fluffy_Pillow 49485.3/1100000: 4% mana | 1.0/5: 20% soul_shard lord_of_flames, accelerando(4)
3:16.755 default R incinerate Fluffy_Pillow 396064.2/1100000: 36% mana | 1.0/5: 20% soul_shard lord_of_flames, accelerando(4)
3:18.083 default R incinerate Fluffy_Pillow 350050.0/1100000: 32% mana | 1.0/5: 20% soul_shard lord_of_flames, accelerando(5)
3:19.392 default G immolate Fluffy_Pillow 303240.8/1100000: 28% mana | 1.0/5: 20% soul_shard lord_of_flames
3:20.566 default J conflagrate Fluffy_Pillow 253795.5/1100000: 23% mana | 2.0/5: 40% soul_shard lord_of_flames
3:21.741 default Q chaos_bolt Fluffy_Pillow 270364.3/1100000: 25% mana | 3.0/5: 60% soul_shard lord_of_flames
3:24.086 default C havoc enemy2 303431.5/1100000: 28% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos
3:25.260 default K conflagrate Fluffy_Pillow 231986.2/1100000: 21% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos
3:26.435 default K conflagrate Fluffy_Pillow 248555.0/1100000: 23% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
3:27.608 default Q chaos_bolt Fluffy_Pillow 265348.2/1100000: 24% mana | 3.0/5: 60% soul_shard lord_of_flames, embrace_chaos, accelerando
3:28.996 default K conflagrate Fluffy_Pillow 285220.4/1100000: 26% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando(2)
3:30.136 default Q chaos_bolt Fluffy_Pillow 301786.9/1100000: 27% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando(2)
3:31.501 default R incinerate Fluffy_Pillow 321655.9/1100000: 29% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos, accelerando(3)
3:32.846 default R incinerate Fluffy_Pillow 275491.1/1100000: 25% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos, accelerando(3)
3:34.192 default K conflagrate Fluffy_Pillow 229341.0/1100000: 21% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando(3)
3:35.559 default Q chaos_bolt Fluffy_Pillow 249500.6/1100000: 23% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, accelerando(3)
3:37.800 default R incinerate Fluffy_Pillow 282975.4/1100000: 26% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(4)
3:39.127 default R incinerate Fluffy_Pillow 236315.3/1100000: 21% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
3:40.534 default R incinerate Fluffy_Pillow 190155.6/1100000: 17% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
3:41.941 default E immolate Fluffy_Pillow 143995.9/1100000: 13% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos
3:43.115 default R incinerate Fluffy_Pillow 94550.6/1100000: 9% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos
3:44.523 default S life_tap Fluffy_Pillow 48405.0/1100000: 4% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos
3:45.698 default C havoc enemy2 394973.8/1100000: 36% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos
3:46.873 default P dimensional_rift Fluffy_Pillow 323542.6/1100000: 29% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos
3:48.048 default R incinerate Fluffy_Pillow 340111.4/1100000: 31% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos
3:49.457 default R incinerate Fluffy_Pillow 294155.4/1100000: 27% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, accelerando
3:50.845 default R incinerate Fluffy_Pillow 248027.7/1100000: 23% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, accelerando(2)
3:52.211 default Q chaos_bolt Fluffy_Pillow 201878.4/1100000: 18% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, accelerando(2)
3:54.485 default G immolate Fluffy_Pillow 234924.2/1100000: 21% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando(2)
3:55.623 default J conflagrate Fluffy_Pillow 185491.0/1100000: 17% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando(3)
3:56.745 default K conflagrate Fluffy_Pillow 202037.5/1100000: 18% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando(3)
3:57.867 default N summon_doomguard Fluffy_Pillow 218584.0/1100000: 20% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
3:58.991 default K conflagrate Fluffy_Pillow 235160.0/1100000: 21% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, accelerando(3)
4:00.114 default Q chaos_bolt Fluffy_Pillow 251721.2/1100000: 23% mana | 4.0/5: 80% soul_shard lord_of_flames, accelerando(3)
4:02.355 default Q chaos_bolt Fluffy_Pillow 283663.9/1100000: 26% mana | 3.0/5: 60% soul_shard lord_of_flames, embrace_chaos, nefarious_pact, accelerando
4:03.319 default K conflagrate Fluffy_Pillow 297466.2/1100000: 27% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, nefarious_pact, accelerando(2)
4:04.108 default Q chaos_bolt Fluffy_Pillow 308932.0/1100000: 28% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, nefarious_pact, accelerando(2)
4:05.055 default R incinerate Fluffy_Pillow 322693.8/1100000: 29% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos, nefarious_pact, accelerando(2)
4:06.003 default C havoc enemy2 270470.2/1100000: 25% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos, nefarious_pact, accelerando(2)
4:06.791 default R incinerate Fluffy_Pillow 193921.4/1100000: 18% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos, nefarious_pact, accelerando(2)
4:07.740 default O soul_harvest Fluffy_Pillow 141712.3/1100000: 13% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos, nefarious_pact, accelerando(2)
4:07.740 default R incinerate Fluffy_Pillow 141712.3/1100000: 13% mana | 0.0/5: 0% soul_shard soul_harvest, lord_of_flames, embrace_chaos, nefarious_pact, accelerando(2)
4:08.689 default R incinerate Fluffy_Pillow 89503.2/1100000: 8% mana | 0.0/5: 0% soul_shard soul_harvest, lord_of_flames, embrace_chaos, nefarious_pact, accelerando(2)
4:09.639 default K conflagrate Fluffy_Pillow 37309.9/1100000: 3% mana | 0.0/5: 0% soul_shard soul_harvest, lord_of_flames, nefarious_pact, accelerando(3)
4:10.418 default Q chaos_bolt Fluffy_Pillow 48798.1/1100000: 4% mana | 2.0/5: 40% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, nefarious_pact, accelerando(3)
4:11.970 default R incinerate Fluffy_Pillow 71924.6/1100000: 7% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(4)
4:12.890 default P dimensional_rift Fluffy_Pillow 19690.5/1100000: 2% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(4)
4:13.660 default Q chaos_bolt Fluffy_Pillow 31212.0/1100000: 3% mana | 2.0/5: 40% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(4)
4:14.582 default S life_tap Fluffy_Pillow 44808.7/1100000: 4% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due
4:15.963 default R incinerate Fluffy_Pillow 394282.4/1100000: 36% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due
4:17.619 default E immolate Fluffy_Pillow 351657.5/1100000: 32% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due, accelerando
4:18.983 default Q chaos_bolt Fluffy_Pillow 305185.1/1100000: 28% mana | 2.0/5: 40% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, devils_due, accelerando
4:21.702 default R incinerate Fluffy_Pillow 344112.1/1100000: 31% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due, accelerando(2)
4:23.312 default Q chaos_bolt Fluffy_Pillow 301509.8/1100000: 27% mana | 2.0/5: 40% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
4:24.658 default R incinerate Fluffy_Pillow 321360.6/1100000: 29% mana | 0.0/5: 0% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(4)
4:25.986 default R incinerate Fluffy_Pillow 275231.3/1100000: 25% mana | 0.0/5: 0% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(4)
4:27.315 default C havoc enemy2 229117.1/1100000: 21% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(4)
4:28.422 default G immolate Fluffy_Pillow 157681.0/1100000: 14% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(4)
4:29.527 default J conflagrate Fluffy_Pillow 108199.6/1100000: 10% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos
4:30.701 default Q chaos_bolt Fluffy_Pillow 124754.3/1100000: 11% mana | 3.0/5: 60% soul_shard lord_of_flames
4:33.046 default K conflagrate Fluffy_Pillow 157821.4/1100000: 14% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos
4:34.220 default P dimensional_rift Fluffy_Pillow 174376.1/1100000: 16% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
4:35.392 default Q chaos_bolt Fluffy_Pillow 191155.0/1100000: 17% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
4:36.779 default J conflagrate Fluffy_Pillow 211011.9/1100000: 19% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
4:37.937 default J conflagrate Fluffy_Pillow 227590.3/1100000: 21% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
4:39.092 default L service_imp Fluffy_Pillow 244125.7/1100000: 22% mana | 5.0/5: 100% soul_shard lord_of_flames, embrace_chaos, accelerando
4:40.248 default Q chaos_bolt Fluffy_Pillow 260675.5/1100000: 24% mana | 4.0/5: 80% soul_shard lord_of_flames, embrace_chaos, accelerando
4:41.636 default Q chaos_bolt Fluffy_Pillow 280546.7/1100000: 26% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando
4:43.023 default R incinerate Fluffy_Pillow 300404.5/1100000: 27% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos, accelerando(2)
4:44.389 default J conflagrate Fluffy_Pillow 254255.2/1100000: 23% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos, accelerando(2)
4:45.529 default R incinerate Fluffy_Pillow 270821.7/1100000: 25% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
4:46.894 default R incinerate Fluffy_Pillow 224368.2/1100000: 20% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
4:48.282 default C havoc enemy2 178466.6/1100000: 16% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, accelerando(2)
4:49.422 default Q chaos_bolt Fluffy_Pillow 107033.1/1100000: 10% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, accelerando(2)
4:51.698 default E immolate Fluffy_Pillow 140581.7/1100000: 13% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
4:52.821 default J conflagrate Fluffy_Pillow 91142.9/1100000: 8% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
4:53.941 default Q chaos_bolt Fluffy_Pillow 107660.0/1100000: 10% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
4:55.287 default R incinerate Fluffy_Pillow 127537.0/1100000: 12% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(4)
4:56.615 default R incinerate Fluffy_Pillow 81408.9/1100000: 7% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(5)
4:57.523 default J conflagrate Fluffy_Pillow 29190.7/1100000: 3% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(5)
4:58.356 default Q chaos_bolt Fluffy_Pillow 41834.2/1100000: 4% mana | 3.0/5: 60% soul_shard lord_of_flames, embrace_chaos, nefarious_pact, accelerando(5)
4:59.264 default S life_tap Fluffy_Pillow 55214.3/1100000: 5% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, nefarious_pact
5:00.079 default R incinerate Fluffy_Pillow 396706.7/1100000: 36% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, nefarious_pact
5:01.056 default R incinerate Fluffy_Pillow 344597.8/1100000: 31% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, nefarious_pact, accelerando

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4201 3876 0
Agility 7254 6929 0
Stamina 52473 52473 34105
Intellect 49775 48068 38456 (1278)
Spirit 1 1 0
Health 3148380 3148380 0
Mana 1100000 1100000 0
Soul Shard 5 5 0
Spell Power 49775 48068 0
Crit 20.62% 20.62% 6248
Haste 28.19% 27.19% 10197
Damage / Heal Versatility 3.41% 3.41% 1620
ManaReg per Second 14101 13991 0
Mastery 66.15% 66.15% 5618
Armor 1954 1954 1954
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 906.00
Local Head Eyes of Azj'Aqir
ilevel: 900, stats: { 253 Armor, +3255 Sta, +2170 Int, +1074 Haste, +578 Vers }
Local Neck Radiant String of Scorpid Eyes
ilevel: 900, stats: { +1831 Sta, +2011 Haste, +922 Crit }, enchant: mark_of_the_hidden_satyr
Local Shoulders Pauldrons of Azj'Aqir
ilevel: 900, stats: { 233 Armor, +2442 Sta, +1628 Int, +752 Mastery, +487 Vers }
Local Chest Robes of Fluctuating Energy
ilevel: 900, stats: { 311 Armor, +3255 Sta, +2170 Int, +1145 Haste, +507 Mastery }
Local Waist Man'ari Skullbuckled Cinch
ilevel: 900, stats: { 175 Armor, +2442 Sta, +1628 Int, +699 Haste, +540 Mastery }
Local Legs Leggings of Azj'Aqir
ilevel: 900, stats: { 272 Armor, +3255 Sta, +2170 Int, +932 Crit, +720 Haste }
Local Feet Outcast Wanderer's Footrags
ilevel: 910, stats: { 222 Armor, +2680 Sta, +1786 Int, +864 Crit, +422 Mastery }
Local Wrists Woven Lasher Tendril Bracers
ilevel: 900, stats: { 136 Armor, +1831 Sta, +1221 Int, +644 Haste, +285 Vers }
Local Hands Clutch of Azj'Aqir
ilevel: 900, stats: { 194 Armor, +2442 Sta, +1628 Int, +859 Crit, +380 Mastery }
Local Finger1 Ring of the Scoured Clan
ilevel: 900, stats: { +1831 Sta, +2095 Mastery, +838 Haste }, enchant: { +200 Haste }
Local Finger2 Sephuz's Secret
ilevel: 940, stats: { +2658 Sta, +1068 Haste, +2671 Crit }, enchant: { +200 Haste }
Local Trinket1 Whispers in the Dark
ilevel: 905, stats: { +2162 Int }
Local Trinket2 Erratic Metronome
ilevel: 900, stats: { +2063 Int }
Local Back Astromancer's Greatcloak
ilevel: 905, stats: { 158 Armor, +1918 Sta, +1278 StrAgiInt, +676 Haste, +270 Vers }, enchant: { +200 Int }
Local Main Hand Scepter of Sargeras
ilevel: 929, weapon: { 7005 - 10509, 3.6 }, stats: { +2843 Int, +4265 Sta, +922 Haste, +922 Mastery, +15509 Int }, relics: { +61 ilevels, +59 ilevels, +61 ilevels }

Talents

Level
15 Backdraft (Destruction Warlock) Roaring Blaze (Destruction Warlock) Shadowburn (Destruction Warlock)
30 Reverse Entropy (Destruction Warlock) Eradication (Destruction Warlock) Empowered Life Tap
45 Demonic Circle Mortal Coil Shadowfury
60 Cataclysm (Destruction Warlock) Fire and Brimstone (Destruction Warlock) Soul Harvest
75 Demon Skin Burning Rush Dark Pact
90 Grimoire of Supremacy Grimoire of Service Grimoire of Sacrifice
100 Wreak Havoc (Destruction Warlock) Channel Demonfire (Destruction Warlock) Soul Conduit

Profile

warlock="Sephuz"
level=110
race=troll
role=spell
position=back
talents=2203021
artifact=38:142513:142516:142513:0:803:1:804:3:805:3:806:5:807:3:808:3:809:4:810:3:811:3:812:3:813:1:814:1:815:1:816:1:817:1:818:1:1355:1
spec=destruction

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,type=whispered_pact
actions.precombat+=/food,type=azshari_salad
actions.precombat+=/summon_pet,if=!talent.grimoire_of_supremacy.enabled&(!talent.grimoire_of_sacrifice.enabled|buff.demonic_power.down)
actions.precombat+=/summon_infernal,if=talent.grimoire_of_supremacy.enabled&artifact.lord_of_flames.rank>0
actions.precombat+=/summon_infernal,if=talent.grimoire_of_supremacy.enabled&active_enemies>1
actions.precombat+=/summon_doomguard,if=talent.grimoire_of_supremacy.enabled&active_enemies=1&artifact.lord_of_flames.rank=0
actions.precombat+=/augmentation,type=defiled
actions.precombat+=/snapshot_stats
actions.precombat+=/grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
actions.precombat+=/life_tap,if=talent.empowered_life_tap.enabled&!buff.empowered_life_tap.remains
actions.precombat+=/potion,name=prolonged_power
actions.precombat+=/chaos_bolt

# Executed every time the actor is available.
actions=havoc,target=2,if=active_enemies>1&(active_enemies<4|talent.wreak_havoc.enabled&active_enemies<6)&!debuff.havoc.remains
actions+=/dimensional_rift,if=charges=3
actions+=/immolate,if=remains<=tick_time
actions+=/immolate,cycle_targets=1,if=active_enemies>1&remains<=tick_time&(!talent.roaring_blaze.enabled|(!debuff.roaring_blaze.remains&action.conflagrate.charges<2))
actions+=/immolate,if=talent.roaring_blaze.enabled&remains<=duration&!debuff.roaring_blaze.remains&target.time_to_die>10&(action.conflagrate.charges=2+set_bonus.tier19_4pc|(action.conflagrate.charges>=1+set_bonus.tier19_4pc&action.conflagrate.recharge_time<cast_time+gcd)|target.time_to_die<24)
actions+=/berserking
actions+=/blood_fury
actions+=/arcane_torrent
actions+=/potion,name=deadly_grace,if=(buff.soul_harvest.remains|trinket.proc.any.react|target.time_to_die<=45)
actions+=/shadowburn,if=buff.conflagration_of_chaos.remains<=action.chaos_bolt.cast_time
actions+=/shadowburn,if=(charges=1&recharge_time<action.chaos_bolt.cast_time|charges=2)&soul_shard<5
actions+=/conflagrate,if=talent.roaring_blaze.enabled&(charges=2+set_bonus.tier19_4pc|(charges>=1+set_bonus.tier19_4pc&recharge_time<gcd)|target.time_to_die<24)
actions+=/conflagrate,if=talent.roaring_blaze.enabled&debuff.roaring_blaze.stack>0&dot.immolate.remains>dot.immolate.duration*0.3&(active_enemies=1|soul_shard<3)&soul_shard<5
actions+=/conflagrate,if=!talent.roaring_blaze.enabled&!buff.backdraft.remains&buff.conflagration_of_chaos.remains<=action.chaos_bolt.cast_time
actions+=/conflagrate,if=!talent.roaring_blaze.enabled&!buff.backdraft.remains&(charges=1&recharge_time<action.chaos_bolt.cast_time|charges=2)&soul_shard<5
actions+=/life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<=gcd
actions+=/dimensional_rift,if=equipped.144369&!buff.lessons_of_spacetime.remains&((!talent.grimoire_of_supremacy.enabled&!cooldown.summon_doomguard.remains)|(talent.grimoire_of_service.enabled&!cooldown.service_pet.remains)|(talent.soul_harvest.enabled&!cooldown.soul_harvest.remains))
actions+=/service_pet
actions+=/summon_infernal,if=artifact.lord_of_flames.rank>0&!buff.lord_of_flames.remains
actions+=/summon_doomguard,if=!talent.grimoire_of_supremacy.enabled&spell_targets.infernal_awakening<=2&(target.time_to_die>180|target.health.pct<=20|target.time_to_die<30)
actions+=/summon_infernal,if=!talent.grimoire_of_supremacy.enabled&spell_targets.infernal_awakening>2
actions+=/summon_doomguard,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal=1&artifact.lord_of_flames.rank>0&buff.lord_of_flames.remains&!pet.doomguard.active
actions+=/summon_doomguard,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal=1&equipped.132379&!cooldown.sindorei_spite_icd.remains
actions+=/summon_infernal,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal>1&equipped.132379&!cooldown.sindorei_spite_icd.remains
actions+=/soul_harvest
actions+=/channel_demonfire,if=dot.immolate.remains>cast_time
actions+=/havoc,if=active_enemies=1&talent.wreak_havoc.enabled&equipped.132375&!debuff.havoc.remains
actions+=/rain_of_fire,if=active_enemies>=3&cooldown.havoc.remains<=12&!talent.wreak_havoc.enabled
actions+=/rain_of_fire,if=active_enemies>=6&talent.wreak_havoc.enabled
actions+=/dimensional_rift,if=!equipped.144369|charges>1|((!talent.grimoire_of_service.enabled|recharge_time<cooldown.service_pet.remains)&(!talent.soul_harvest.enabled|recharge_time<cooldown.soul_harvest.remains)&(!talent.grimoire_of_supremacy.enabled|recharge_time<cooldown.summon_doomguard.remains))
actions+=/life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<duration*0.3
actions+=/cataclysm
actions+=/chaos_bolt,if=(cooldown.havoc.remains>12&cooldown.havoc.remains|active_enemies<3|talent.wreak_havoc.enabled&active_enemies<6)
actions+=/shadowburn
actions+=/conflagrate,if=!talent.roaring_blaze.enabled&!buff.backdraft.remains
actions+=/immolate,if=!talent.roaring_blaze.enabled&remains<=duration*0.3
actions+=/incinerate
actions+=/life_tap

head=eyes_of_azjaqir,id=138314,bonus_id=3445
neck=radiant_string_of_scorpid_eyes,id=140898,bonus_id=3445,enchant_id=5439
shoulders=pauldrons_of_azjaqir,id=138323,bonus_id=3445
back=astromancers_greatcloak,id=140909,bonus_id=3518,enchant_id=5436
chest=robes_of_fluctuating_energy,id=140848,bonus_id=3445
wrists=woven_lasher_tendril_bracers,id=140886,bonus_id=3445
hands=clutch_of_azjaqir,id=138311,bonus_id=3445
waist=manari_skullbuckled_cinch,id=140887,bonus_id=3445
legs=leggings_of_azjaqir,id=138317,bonus_id=3445
feet=outcast_wanderers_footrags,id=140914,bonus_id=3519
finger1=ring_of_the_scoured_clan,id=140897,bonus_id=3445,enchant=binding_of_haste
finger2=sephuzs_secret,id=132452,ilevel=940,enchant=binding_of_haste
trinket1=whispers_in_the_dark,id=140809,ilevel=905
trinket2=erratic_metronome,id=140792,ilevel=900
main_hand=scepter_of_sargeras,id=128941,ilevel=929,gem_id=140826/140837/140826,relic_id=3519/3518:3518/3519

# Gear Summary
# gear_ilvl=905.93
# gear_stamina=34105
# gear_intellect=38456
# gear_crit_rating=6248
# gear_haste_rating=10197
# gear_mastery_rating=5618
# gear_versatility_rating=1620
# gear_armor=1954
# set_bonus=tier19_2pc=1
# set_bonus=tier19_4pc=1
default_pet=imp

Shoulders : 1038597 dps, 609265 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
1038597.4 1038597.4 0.0 / 0.000% 0.0 / 0.0% 32.3
RPS Out RPS In Primary Resource Waiting APM Active Skill
26303.4 26303.4 Mana 0.00% 50.6 100.0% 100%
Talents
  • 15: Roaring Blaze (Destruction Warlock)
  • 30: Eradication (Destruction Warlock)
  • 60: Soul Harvest
  • 90: Grimoire of Service
  • 100: Wreak Havoc (Destruction Warlock)
  • Talent Calculator
Artifact

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Shoulders 1038597
Chaos Bolt 334243 32.2% 57.4 5.10sec 1749304 1150883 Direct 109.6 0 916824 916824 100.0%  

Stats details: chaos_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 57.45 109.61 0.00 0.00 1.5200 0.0000 100491667.83 100491667.83 0.00 1150883.19 1150883.19
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 109.61 100.00% 916823.98 571056 1503102 917277.77 850255 988250 100491668 100491668 0.00
 
 

Action details: chaos_bolt

Static Values
  • id:116858
  • school:chromatic
  • resource:soul_shard
  • range:40.0
  • travel_speed:16.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:2.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:116858
  • name:Chaos Bolt
  • school:chromatic
  • tooltip:
  • description:Unleashes a devastating blast of chaos, causing {$s1=1} Chaos damage. Chaos Bolt always critically strikes and your critical strike chance increases its damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:4.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Conflagrate 112320 10.8% 48.3 6.22sec 698567 671226 Direct 96.1 206977 468979 351182 55.0%  

Stats details: conflagrate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 48.30 96.07 0.00 0.00 1.0408 0.0000 33738516.11 33738516.11 0.00 671226.25 671226.25
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 43.20 44.96% 206976.80 130243 342811 207120.67 177989 239523 8940467 8940467 0.00
crit 52.88 55.04% 468979.18 260480 791920 469183.79 396644 522892 24798049 24798049 0.00
 
 

Action details: conflagrate

Static Values
  • id:17962
  • school:fire
  • resource:chi
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:9.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.roaring_blaze.enabled&(charges=2+set_bonus.tier19_4pc|(charges>=1+set_bonus.tier19_4pc&recharge_time<gcd)|target.time_to_die<24)
Spelldata
  • id:17962
  • name:Conflagrate
  • school:fire
  • tooltip:
  • description:Triggers an explosion on the target, dealing {$s1=1} Fire damage.{$?s196406=false}[ Reduces the cast time of Incinerate and Chaos Bolt by {$117828s1=30}% for {$117828d=10 seconds}.][] |cFFFFFFFFGenerates 1 Soul Shard.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.265510
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Deadly Grace 5436 0.5% 14.2 2.09sec 112672 0 Direct 14.2 97771 195509 112676 15.2%  

Stats details: deadly_grace

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.24 14.24 0.00 0.00 0.0000 0.0000 1604691.84 1604691.84 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 12.07 84.75% 97770.60 83077 109661 97791.26 86769 107377 1180167 1180167 0.00
crit 2.17 15.25% 195509.31 166153 219322 176123.34 0 219322 424525 424525 0.00
 
 

Action details: deadly_grace

Static Values
  • id:188091
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:25.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188091
  • name:Deadly Grace
  • school:arcane
  • tooltip:
  • description:Deal {$s1=63339 to 95008} Arcane damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:63338.72
  • base_dd_max:95008.08
 
Immolate 249240 24.0% 19.9 15.28sec 3760148 3566094 Direct 38.6 142694 285474 210485 47.5%  
Periodic 293.0 154454 309122 227837 47.4% 195.9%

Stats details: immolate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 19.91 38.56 292.96 292.96 1.0544 2.0137 74863014.65 74863014.65 0.00 122537.02 3566094.16
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 20.25 52.52% 142694.19 90359 237797 142730.98 122017 168114 2889878 2889878 0.00
crit 18.31 47.48% 285474.21 180717 475641 285507.33 239746 333384 5226080 5226080 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 154.0 52.56% 154453.78 40 472534 154722.98 130594 178070 23780978 23780978 0.00
crit 139.0 47.44% 309122.33 177 945063 309657.02 257620 368101 42966078 42966078 0.00
 
 

Action details: immolate

Static Values
  • id:348
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:66000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.32
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:remains<=tick_time
Spelldata
  • id:348
  • name:Immolate
  • school:fire
  • tooltip:
  • description:Burns the enemy, causing {$s1=1} Fire damage immediately and an additional $157736o1 Fire damage over {$157736d=18 seconds}. |cFFFFFFFFPeriodic damage has a {$193541s1=15}% chance to generate 1 Soul Shard. Chance doubled on critical strikes.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.332000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.721500
  • base_td:0.00
  • dot_duration:18.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Incinerate 139489 13.5% 80.2 3.59sec 523196 424425 Direct 153.7 236338 472929 273089 15.5%  

Stats details: incinerate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 80.23 153.72 0.00 0.00 1.2327 0.0000 41978226.18 41978226.18 0.00 424425.48 424425.48
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 129.84 84.47% 236337.78 146064 384465 236465.22 220701 253866 30685567 30685567 0.00
crit 23.88 15.53% 472929.45 292161 768923 473202.58 403165 561625 11292659 11292659 0.00
 
 

Action details: incinerate

Static Values
  • id:29722
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:66000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:29722
  • name:Incinerate
  • school:fire
  • tooltip:
  • description:Draws fire toward the enemy, dealing {$s2=0} Fire damage.{$?s29722=true}|!c3[][ Replaces Shadow Bolt.]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.331000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Mark of the Hidden Satyr 9267 0.9% 19.9 15.01sec 139591 0 Direct 19.9 120766 241565 139590 15.6%  

Stats details: mark_of_the_hidden_satyr

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 19.95 19.95 0.00 0.00 0.0000 0.0000 2784552.89 2784552.89 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 16.84 84.42% 120765.87 110553 153492 120795.81 111190 135087 2033597 2033597 0.00
crit 3.11 15.58% 241564.95 221106 306985 230355.63 0 306985 750956 750956 0.00
 
 

Action details: mark_of_the_hidden_satyr

Static Values
  • id:191259
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191259
  • name:Mark of the Hidden Satyr
  • school:fire
  • tooltip:
  • description:Deals fire damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:2.500000
  • spell_power_mod.direct:2.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
pet - imp 44149 / 44149
Firebolt 44149 4.3% 108.5 2.77sec 122249 100173 Direct 107.7 106647 213207 123194 15.5%  

Stats details: firebolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 108.54 107.71 0.00 0.00 1.2204 0.0000 13268505.20 13268505.20 0.00 100172.93 100172.93
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 90.98 84.47% 106647.43 65228 135843 106695.40 103273 110916 9703046 9703046 0.00
crit 16.72 15.53% 213207.11 130455 271687 213293.66 187012 238373 3565460 3565460 0.00
 
 

Action details: firebolt

Static Values
  • id:3110
  • school:fire
  • resource:energy
  • range:40.0
  • travel_speed:16.0000
  • trigger_gcd:0.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.75
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:3110
  • name:Firebolt
  • school:fire
  • tooltip:
  • description:Deals {$s1=1} Fire damage to a target.$?a231795[ Damage increased by {$231795s1=50}% if you have Immolated the target.][] |cFF777777(Right-Click to toggle)|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
pet - service_imp 129256 / 41227
Firebolt 129256 4.0% 49.0 5.55sec 252050 219983 Direct 48.7 219461 438659 253494 15.5%  

Stats details: firebolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 49.00 48.72 0.00 0.00 1.1458 0.0000 12349614.16 12349614.16 0.00 219982.80 219982.80
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 41.15 84.47% 219461.10 130455 271687 219728.01 206012 232661 9031474 9031474 0.00
crit 7.56 15.53% 438658.74 260910 543373 439007.23 0 543373 3318140 3318140 0.00
 
 

Action details: firebolt

Static Values
  • id:3110
  • school:fire
  • resource:energy
  • range:40.0
  • travel_speed:16.0000
  • trigger_gcd:0.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.75
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:3110
  • name:Firebolt
  • school:fire
  • tooltip:
  • description:Deals {$s1=1} Fire damage to a target.$?a231795[ Damage increased by {$231795s1=50}% if you have Immolated the target.][] |cFF777777(Right-Click to toggle)|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
pet - infernal 125449 / 10624
Immolation 97725 0.8% 1.0 0.00sec 2443224 0 Periodic 46.4 45558 91143 52664 15.6% 8.1%

Stats details: immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 23.20 46.39 0.0000 1.0511 2443223.54 2443223.54 0.00 100206.03 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 39.2 84.41% 45557.73 36338 47966 45559.71 42798 47433 1784013 1784013 0.00
crit 7.2 15.59% 91143.04 72676 95933 91120.78 0 95933 659210 659210 0.00
 
 

Action details: immolation

Static Values
  • id:19483
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!ticking
Spelldata
  • id:19483
  • name:Immolation
  • school:fire
  • tooltip:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
 

Action details: immolation_tick

Static Values
  • id:20153
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all enemies near the caster.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
melee 27724 0.2% 22.0 1.11sec 31489 28494 Direct 22.0 27269 54543 31489 15.5%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.01 22.01 0.00 0.00 1.1052 0.0000 693133.02 1018971.19 31.98 28493.51 28493.51
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 18.61 84.53% 27268.94 21730 28684 27268.65 25284 28684 507353 745858 31.98
crit 3.41 15.47% 54542.54 43461 57368 53206.82 0 57368 185780 273114 31.18
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
pet - doomguard 97651 / 8263
Doom Bolt 97651 0.8% 10.9 2.21sec 224316 103768 Direct 10.9 194381 388684 224329 15.4%  

Stats details: doom_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.88 10.88 0.00 0.00 2.1618 0.0000 2441338.02 2441338.02 0.00 103767.50 103767.50
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 9.21 84.59% 194380.88 182414 240786 194392.38 182414 234300 1789401 1789401 0.00
crit 1.68 15.41% 388683.78 364827 481572 326896.43 0 481572 651937 651937 0.00
 
 

Action details: doom_bolt

Static Values
  • id:85692
  • school:shadow
  • resource:energy
  • range:30.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:35.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:85692
  • name:Doom Bolt
  • school:shadow
  • tooltip:
  • description:Sends a shadowy bolt at the enemy, causing {$s1=1} Shadow damage. Deals {$s2=20}% additional damage to targets below 20% health.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
pet - lord_of_flames_infernal 125367 / 10616
Immolation 97664 0.8% 1.0 0.00sec 2441699 0 Periodic 46.4 45556 91161 52631 15.5% 8.1%

Stats details: immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 23.20 46.39 0.0000 1.0511 2441699.37 2441699.37 0.00 100143.52 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 39.2 84.48% 45556.13 36338 47966 45557.90 42625 47261 1785538 1785538 0.00
crit 7.2 15.52% 91160.56 72676 95933 91135.87 0 95933 656162 656162 0.00
 
 

Action details: immolation

Static Values
  • id:19483
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!ticking
Spelldata
  • id:19483
  • name:Immolation
  • school:fire
  • tooltip:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
 

Action details: immolation_tick

Static Values
  • id:20153
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all enemies near the caster.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
melee 27703 0.2% 22.0 1.11sec 31465 28472 Direct 22.0 27272 54508 31465 15.4%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.01 22.01 0.00 0.00 1.1052 0.0000 692599.40 1018186.72 31.98 28471.57 28471.57
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 18.62 84.60% 27272.09 21730 28684 27272.22 25083 28418 507887 746642 31.98
crit 3.39 15.40% 54508.00 43461 57368 53121.94 0 57368 184712 271545 31.14
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
pet - lord_of_flames_infernal 125406 / 10619
Immolation 97670 0.8% 1.0 0.00sec 2441837 0 Periodic 46.4 45560 91121 52634 15.5% 8.1%

Stats details: immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 23.20 46.39 0.0000 1.0511 2441836.81 2441836.81 0.00 100149.16 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 39.2 84.47% 45559.75 36338 47966 45560.56 42578 47223 1785400 1785400 0.00
crit 7.2 15.53% 91121.11 72676 95933 91122.38 0 95933 656437 656437 0.00
 
 

Action details: immolation

Static Values
  • id:19483
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!ticking
Spelldata
  • id:19483
  • name:Immolation
  • school:fire
  • tooltip:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
 

Action details: immolation_tick

Static Values
  • id:20153
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all enemies near the caster.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
melee 27736 0.2% 22.0 1.11sec 31503 28506 Direct 22.0 27263 54610 31504 15.5%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.01 22.01 0.00 0.00 1.1052 0.0000 693434.88 1019414.96 31.98 28505.91 28505.91
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 18.60 84.49% 27262.78 21730 28684 27262.44 25343 28432 507052 745414 31.98
crit 3.41 15.51% 54609.73 43461 57368 53292.68 0 57368 186383 274001 31.20
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
pet - lord_of_flames_infernal 125285 / 10610
Immolation 97553 0.8% 1.0 0.00sec 2438934 0 Periodic 46.4 45558 91140 52573 15.4% 8.1%

Stats details: immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 23.20 46.39 0.0000 1.0511 2438933.61 2438933.61 0.00 100030.09 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 39.3 84.61% 45558.02 36338 47966 45560.86 42849 47433 1788303 1788303 0.00
crit 7.1 15.39% 91140.26 72676 95933 91103.05 0 95933 650630 650630 0.00
 
 

Action details: immolation

Static Values
  • id:19483
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!ticking
Spelldata
  • id:19483
  • name:Immolation
  • school:fire
  • tooltip:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
 

Action details: immolation_tick

Static Values
  • id:20153
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all enemies near the caster.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
melee 27732 0.2% 22.0 1.11sec 31498 28501 Direct 22.0 27267 54559 31498 15.5%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.01 22.01 0.00 0.00 1.1052 0.0000 693327.00 1019256.36 31.98 28501.48 28501.48
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 18.60 84.50% 27267.45 21730 28684 27267.77 25542 28684 507159 745572 31.98
crit 3.41 15.50% 54558.77 43461 57368 53188.34 0 57368 186168 273684 31.17
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
pet - shadowy_tear 117790 / 22343
Shadow Bolt 117790 2.1% 4.4 59.48sec 1513895 0 Periodic 48.3 119680 239426 138205 15.5% 20.0%

Stats details: shadow_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.41 0.00 48.60 48.34 0.0000 1.2363 6680998.68 6680998.68 0.00 111183.20 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 40.9 84.53% 119680.09 59 147590 119522.96 0 147590 4890361 4890361 0.00
crit 7.5 15.47% 239425.75 233 295181 237046.15 0 295181 1790638 1790638 0.00
 
 

Action details: shadow_bolt

Static Values
  • id:196657
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:196657
  • name:Shadow Bolt
  • school:shadow
  • tooltip:
  • description:Sends a shadowy bolt at the enemy, causing {$s1=1} Shadow damage.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:14.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
pet - chaos_tear 144229 / 10547
Chaos Bolt 144229 1.0% 4.4 58.17sec 719848 357026 Direct 4.4 0 724919 724919 100.0%  

Stats details: chaos_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.39 4.36 0.00 0.00 2.0164 0.0000 3161107.31 3161107.31 0.00 357025.90 357025.90
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 4.36 100.00% 724918.97 675308 852366 725508.12 0 852366 3161107 3161107 0.00
 
 

Action details: chaos_bolt

Static Values
  • id:215279
  • school:chromatic
  • resource:none
  • range:100.0
  • travel_speed:16.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:5.500
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:215279
  • name:Chaos Bolt
  • school:chromatic
  • tooltip:
  • description:Unleashes a devastating blast of chaos, causing {$s1=1} Chaos damage. Chaos Bolt always critically strikes and your critical strike chance increases its damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:5.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
pet - chaos_portal 252492 / 19963
Chaos Barrage 252492 1.9% 4.4 58.24sec 1367877 0 Periodic 150.5 34370 68734 39708 15.5% 7.9%

Stats details: chaos_barrage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.37 0.00 151.19 150.51 0.0000 0.1571 5976245.28 5976245.28 0.00 251631.38 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 127.1 84.46% 34369.80 144 40588 34309.02 0 40588 4369137 4369137 0.00
crit 23.4 15.54% 68734.39 333 81177 68596.58 0 81177 1607109 1607109 0.00
 
 

Action details: chaos_barrage

Static Values
  • id:187394
  • school:magic
  • resource:none
  • range:100.0
  • travel_speed:24.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:187394
  • name:Chaos Barrage
  • school:magic
  • tooltip:
  • description:Deals {$s1=1} Chaos damage.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:5.50
  • base_tick_time:0.25
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Simple Action Stats Execute Interval
Shoulders
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Shoulders
  • harmful:false
  • if_expr:
 
Berserking 2.1 180.63sec

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.07 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=15}%.
  • description:Increases your haste by {$s1=15}% for {$d=10 seconds}.
 
Dimensional Rift 13.1 23.34sec

Stats details: dimensional_rift

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.12 0.00 0.00 0.00 1.0227 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: dimensional_rift

Static Values
  • id:196586
  • school:none
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:45.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:charges=3
Spelldata
  • id:196586
  • name:Dimensional Rift
  • school:chaos
  • tooltip:
  • description:Rips a hole in time and space, opening a portal that damages your target.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Shoulders
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Shoulders
  • harmful:false
  • if_expr:
 
Havoc 14.9 20.91sec

Stats details: havoc

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.90 0.00 0.00 0.00 1.0687 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: havoc

Static Values
  • id:80240
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:88000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies>1&(active_enemies<4|talent.wreak_havoc.enabled&active_enemies<6)&!debuff.havoc.remains
Spelldata
  • id:80240
  • name:Havoc
  • school:shadow
  • tooltip:Spells cast by the Warlock also hit this target.
  • description:Marks a target with Havoc for {$d=8 seconds}, causing your single target spells to also strike the Havoc victim. Limit 1.
 
Life Tap 7.6 30.24sec

Stats details: life_tap

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.58 0.00 0.00 0.00 1.0499 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: life_tap

Static Values
  • id:1454
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.empowered_life_tap.enabled&!buff.empowered_life_tap.remains
Spelldata
  • id:1454
  • name:Life Tap
  • school:shadow
  • tooltip:
  • description:Restores {$s1=30}% of your maximum mana, at the cost of {$s2=10}% of your maximum health.
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Grimoire: Imp (service_imp) 3.7 91.86sec

Stats details: service_imp

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.67 0.00 0.00 0.00 0.9748 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: service_imp

Static Values
  • id:111859
  • school:shadow
  • resource:soul_shard
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:90.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:111859
  • name:Grimoire: Imp
  • school:shadow
  • tooltip:
  • description:Summons an Imp who attacks the target for {$108501s1=25} sec. Imps cast ranged Firebolts and cleanse a hostile magic effect from their master.
 
Soul Harvest 2.9 120.95sec

Stats details: soul_harvest

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.89 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: soul_harvest

Static Values
  • id:196098
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:196098
  • name:Soul Harvest
  • school:shadow
  • tooltip:Damage increased by {$s1=20}%.
  • description:Increases your damage and your pets' damage by {$s1=20}%. Lasts {$d=15 seconds}, increased by {$s2=2} sec for each target afflicted by your {$?s137043=false}[Agony][]{$?s137044=false}[Doom][]{$?s137046=false}[Immolate][], up to a maximum of {$s3=35} sec.
 
Summon Doomguard 1.0 0.00sec

Stats details: summon_doomguard

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 1.0829 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_doomguard

Static Values
  • id:18540
  • school:shadow
  • resource:soul_shard
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.grimoire_of_supremacy.enabled&active_enemies=1&artifact.lord_of_flames.rank=0
Spelldata
  • id:18540
  • name:Summon Doomguard
  • school:shadow
  • tooltip:
  • description:Summons a Doomguard for {$60478d=25 seconds} to assault the target with its Doom Bolts.
 
Summon Imp 1.0 0.00sec

Stats details: summon_imp

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_imp

Static Values
  • id:688
  • school:shadow
  • resource:soul_shard
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!talent.grimoire_of_supremacy.enabled&(!talent.grimoire_of_sacrifice.enabled|buff.demonic_power.down)
Spelldata
  • id:688
  • name:Summon Imp
  • school:shadow
  • tooltip:
  • description:Summons an Imp under your command that casts ranged Firebolts.$?s74434[ |cFFFFFFFFSoulburn:|r |cFF8282FFInstant cast.|r][]
 
Summon Infernal 1.0 0.00sec

Stats details: summon_infernal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.7587 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_infernal

Static Values
  • id:1122
  • school:shadow
  • resource:soul_shard
  • range:30.0
  • travel_speed:1.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.grimoire_of_supremacy.enabled&artifact.lord_of_flames.rank>0
Spelldata
  • id:1122
  • name:Summon Infernal
  • school:shadow
  • tooltip:
  • description:Summons an Infernal from the Twisting Nether, impacting for {$22703s1=0} Fire damage and stunning all enemy targets in the area for {$22703d=2 seconds}. The Infernal will serve you for {$111685d=25 seconds}, dealing strong area-of-effect damage.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Accelerando 20.1 0.0 15.4sec 15.4sec 78.49% 78.49% 1.4(1.4) 19.3

Buff details

  • buff initial source:Shoulders
  • cooldown name:buff_accelerando
  • max_stacks:5
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:734.41

Stack Uptimes

  • accelerando_1:29.73%
  • accelerando_2:24.65%
  • accelerando_3:14.63%
  • accelerando_4:6.56%
  • accelerando_5:2.93%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225719
  • name:Accelerando
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc225125=Your damaging spells have a chance to grant you {$225719s1=528} Haste for {$225719d=12 seconds}, stacking up to 5 times. Stacking does not refresh duration.}
  • max_stacks:5
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Berserking 2.1 0.0 180.6sec 180.6sec 6.87% 8.37% 0.0(0.0) 2.0

Buff details

  • buff initial source:Shoulders
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:10.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • berserking_1:6.87%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=15}%.
  • description:Increases your haste by {$s1=15}% for {$d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.55% 15.47% 0.0(0.0) 1.0

Buff details

  • buff initial source:Shoulders
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:13.55%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Conflagration of Chaos 24.1 0.0 12.4sec 12.4sec 49.23% 46.81% 0.0(0.0) 1.0

Buff details

  • buff initial source:Shoulders
  • cooldown name:buff_conflagration_of_chaos
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:50.00%
  • default_value:-0.00

Stack Uptimes

  • conflagration_of_chaos_1:49.23%

Trigger Attempt Success

  • trigger_pct:49.89%

Spelldata details

  • id:196546
  • name:Conflagration of Chaos
  • tooltip:Your {$?s17877=false}[Shadowburn][Conflagrate] will always critically strike. Critical strike chance will increase the critical strike damage of {$?s17877=false}[Shadowburn][Conflagrate].
  • description:{$@spelldesc219195={$?s17877=false}[Shadowburn][Conflagrate] has a chance to guarantee your next {$?s17877=false}[Shadowburn][Conflagrate] critically strikes, and to increase its damage by your critical strike chance.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Devil's Due 3.5 0.0 69.7sec 69.7sec 8.75% 10.27% 0.0(0.0) 3.2

Buff details

  • buff initial source:Shoulders
  • cooldown name:buff_devils_due
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.18

Stack Uptimes

  • devils_due_1:8.75%

Trigger Attempt Success

  • trigger_pct:99.90%

Spelldata details

  • id:225776
  • name:Devil's Due
  • tooltip:Cast speed slowed by {$s1=7}%.
  • description:{$@spelldesc225142=Your damaging spells have a chance to grant Nefarious Pact, increasing your casting speed by {$225774s1=17}% for {$225774d=12 seconds}. When Nefarious Pact expires, your casting speed is decreased by {$225776s1=7}% for {$225776d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Embrace Chaos 26.3 32.1 11.7sec 5.1sec 59.45% 66.90% 32.1(32.1) 25.7

Buff details

  • buff initial source:Shoulders
  • cooldown name:buff_embrace_chaos
  • max_stacks:1
  • duration:4.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • embrace_chaos_1:59.45%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:212019
  • name:Embrace Chaos
  • tooltip:Chaos Bolt has {$s1=40}% reduced cast time.
  • description:{$@spelldesc212018=Casting Chaos Bolt reduces the cast time of your next Chaos Bolt by {$212019s1=40}% for {$212019d=4 seconds}.}
  • max_stacks:0
  • duration:4.00
  • cooldown:0.00
  • default_chance:0.00%
Lessons of Space-Time 12.1 1.0 25.6sec 23.4sec 40.98% 40.98% 1.0(1.0) 11.7

Buff details

  • buff initial source:Shoulders
  • cooldown name:buff_lessons_of_spacetime
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • lessons_of_spacetime_1:40.98%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:236176
  • name:Lessons of Space-Time
  • tooltip:You and your minions deal {$s1=10}% increased damage.
  • description:{$@spelldesc236174=While you have a Dimensional Rift open, all of your damage is increased by {$236176s1=10}%.}
  • max_stacks:0
  • duration:5.00
  • cooldown:0.00
  • default_chance:0.00%
Lord of Flames 1.0 0.0 0.0sec 0.0sec 97.83% 97.83% 0.0(0.0) 0.0

Buff details

  • buff initial source:Shoulders
  • cooldown name:buff_lord_of_flames
  • max_stacks:1
  • duration:600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • lord_of_flames_1:97.83%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:226802
  • name:Lord of Flames
  • tooltip:Recently activated Lord of Flames.
  • description:{$@spelldesc224103=Once every {$s2=10} minutes, {$?s152107=false}[your Infernal's Meteor Strike][Summon Infernal] will summon {$s3=3} additional Infernals to serve you for {$226804d=25 seconds}.}
  • max_stacks:0
  • duration:600.00
  • cooldown:0.00
  • default_chance:0.00%
Nefarious Pact 3.5 0.0 70.0sec 69.3sec 13.59% 15.07% 0.0(0.0) 3.3

Buff details

  • buff initial source:Shoulders
  • cooldown name:buff_nefarious_pact
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.44

Stack Uptimes

  • nefarious_pact_1:13.59%

Trigger Attempt Success

  • trigger_pct:99.90%

Spelldata details

  • id:225774
  • name:Nefarious Pact
  • tooltip:Cast speed increased by {$s1=17}%.
  • description:{$@spelldesc225142=Your damaging spells have a chance to grant Nefarious Pact, increasing your casting speed by {$225774s1=17}% for {$225774d=12 seconds}. When Nefarious Pact expires, your casting speed is decreased by {$225776s1=7}% for {$225776d=8 seconds}.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of Deadly Grace 1.0 0.0 0.0sec 0.0sec 10.16% 10.16% 0.0(0.0) 1.0

Buff details

  • buff initial source:Shoulders
  • cooldown name:buff_potion_of_deadly_grace
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_deadly_grace_1:10.16%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188027
  • name:Potion of Deadly Grace
  • tooltip:Your attacks have a chance to unleash a bolt of energy at your target.
  • description:Grants your attacks a chance to unleash a bolt of energy at your target. Staying away from enemies for the entire duration of the effect will extend the effect by an additional 5 seconds.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
Potion of Prolonged Power 1.0 0.0 0.0sec 0.0sec 19.64% 19.64% 0.0(0.0) 1.0

Buff details

  • buff initial source:Shoulders
  • cooldown name:buff_potion_of_prolonged_power
  • max_stacks:1
  • duration:60.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:all
  • amount:2500.00

Stack Uptimes

  • potion_of_prolonged_power_1:19.64%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:229206
  • name:Potion of Prolonged Power
  • tooltip:All stats increased by {$s1=2500}.
  • description:Drink to increase all stats by {$s1=2500} for {$d=60 seconds}.
  • max_stacks:0
  • duration:60.00
  • cooldown:1.00
  • default_chance:0.00%
Soul Harvest 2.9 0.0 121.0sec 121.0sec 17.74% 17.74% 0.0(0.0) 2.7

Buff details

  • buff initial source:Shoulders
  • cooldown name:buff_soul_harvest
  • max_stacks:1
  • duration:15.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • soul_harvest_1:17.74%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:196098
  • name:Soul Harvest
  • tooltip:Damage increased by {$s1=20}%.
  • description:Increases your damage and your pets' damage by {$s1=20}%. Lasts {$d=15 seconds}, increased by {$s2=2} sec for each target afflicted by your {$?s137043=false}[Agony][]{$?s137044=false}[Doom][]{$?s137046=false}[Immolate][], up to a maximum of {$s3=35} sec.
  • max_stacks:0
  • duration:15.00
  • cooldown:120.00
  • default_chance:0.00%
Constant Buffs
Well Fed (azshari_salad)

Buff details

  • buff initial source:Shoulders
  • cooldown name:buff_azshari_salad
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:375.00

Stack Uptimes

  • azshari_salad_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225603
  • name:Well Fed
  • tooltip:Haste increased by $w1.
  • description:Increases haste by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Defiled Augmentation

Buff details

  • buff initial source:Shoulders
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Whispered Pact

Buff details

  • buff initial source:Shoulders
  • cooldown name:buff_flask_of_the_whispered_pact
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:1300.00

Stack Uptimes

  • flask_of_the_whispered_pact_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188031
  • name:Flask of the Whispered Pact
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%

Procs

Count Interval
shadowy_tear 4.4 58.8sec
chaos_tear 4.4 58.5sec
chaos_portal 4.3 58.9sec
dimension_ripper 4.0 54.1sec

Resources

Resource Usage Type Count Total Average RPE APR
Shoulders
chaos_bolt Soul Shard 58.4 116.9 2.0 2.0 859688.4
havoc Mana 14.9 1311035.5 88000.0 88000.2 0.0
immolate Mana 19.9 1314048.6 66000.0 66000.8 57.0
incinerate Mana 80.2 5295459.2 66000.0 66000.0 7.9
service_imp Soul Shard 3.7 3.7 1.0 1.0 0.0
summon_doomguard Soul Shard 1.0 1.0 1.0 1.0 0.0
summon_infernal Soul Shard 1.0 1.0 1.0 1.0 0.0
pet - imp
firebolt Energy 108.5 4341.5 40.0 40.0 3056.2
pet - service_imp
firebolt Energy 49.0 1959.9 40.0 40.0 6301.1
pet - doomguard
doom_bolt Energy 10.9 380.9 35.0 35.0 6408.9
Resource Gains Type Count Total Average Overflow
life_tap Mana 7.58 2500946.72 (35.44%) 330000.00 0.00 0.00%
immolate Soul Shard 64.72 64.22 (52.98%) 0.99 0.50 0.77%
conflagrate Soul Shard 48.30 48.25 (39.80%) 1.00 0.05 0.10%
mp5_regen Mana 475.53 4556047.14 (64.56%) 9581.07 62053.22 1.34%
soulsnatcher Soul Shard 8.74 8.74 (7.21%) 1.00 0.00 0.00%
pet - imp
energy_regen Energy 1900.65 4175.35 (100.00%) 2.20 21.56 0.51%
pet - service_imp
energy_regen Energy 441.26 1339.23 (100.00%) 3.04 61.69 4.40%
pet - doomguard
energy_regen Energy 15.66 339.89 (100.00%) 21.70 42.75 11.17%
Resource RPS-Gain RPS-Loss
Health 0.00 8027.32
Mana 23435.49 26303.37
Soul Shard 0.40 0.41
Combat End Resource Mean Min Max
Mana 235525.29 5167.37 512360.79
Soul Shard 1.63 0.00 5.00

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 0.9%

Statistics & Data Analysis

Fight Length
Sample Data Shoulders Fight Length
Count 9999
Mean 301.12
Minimum 221.26
Maximum 379.15
Spread ( max - min ) 157.89
Range [ ( max - min ) / 2 * 100% ] 26.22%
DPS
Sample Data Shoulders Damage Per Second
Count 9999
Mean 1038597.40
Minimum 910798.09
Maximum 1197345.50
Spread ( max - min ) 286547.41
Range [ ( max - min ) / 2 * 100% ] 13.79%
Priority Target DPS
Sample Data Shoulders Priority Target Damage Per Second
Count 9999
Mean 609265.14
Minimum 530963.88
Maximum 715470.69
Spread ( max - min ) 184506.81
Range [ ( max - min ) / 2 * 100% ] 15.14%
DPS(e)
Sample Data Shoulders Damage Per Second (Effective)
Count 9999
Mean 1038597.40
Minimum 910798.09
Maximum 1197345.50
Spread ( max - min ) 286547.41
Range [ ( max - min ) / 2 * 100% ] 13.79%
Damage
Sample Data Shoulders Damage
Count 9999
Mean 255460669.49
Minimum 181787665.56
Maximum 337713095.07
Spread ( max - min ) 155925429.52
Range [ ( max - min ) / 2 * 100% ] 30.52%
DTPS
Sample Data Shoulders Damage Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Shoulders Healing Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS(e)
Sample Data Shoulders Healing Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Shoulders Heal
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Shoulders Healing Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Shoulders Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
ETMI
Sample Data ShouldersTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data Shoulders Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=whispered_pact
1 0.00 food,type=azshari_salad
2 0.00 summon_pet,if=!talent.grimoire_of_supremacy.enabled&(!talent.grimoire_of_sacrifice.enabled|buff.demonic_power.down)
3 0.00 summon_infernal,if=talent.grimoire_of_supremacy.enabled&artifact.lord_of_flames.rank>0
4 0.00 summon_infernal,if=talent.grimoire_of_supremacy.enabled&active_enemies>1
5 0.00 summon_doomguard,if=talent.grimoire_of_supremacy.enabled&active_enemies=1&artifact.lord_of_flames.rank=0
6 0.00 augmentation,type=defiled
7 0.00 snapshot_stats
8 0.00 grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
9 0.00 life_tap,if=talent.empowered_life_tap.enabled&!buff.empowered_life_tap.remains
A 0.00 potion,name=prolonged_power
B 0.00 chaos_bolt
Default action list Executed every time the actor is available.
# count action,conditions
C 14.90 havoc,target=2,if=active_enemies>1&(active_enemies<4|talent.wreak_havoc.enabled&active_enemies<6)&!debuff.havoc.remains
D 1.00 dimensional_rift,if=charges=3
E 10.30 immolate,if=remains<=tick_time
F 0.62 immolate,cycle_targets=1,if=active_enemies>1&remains<=tick_time&(!talent.roaring_blaze.enabled|(!debuff.roaring_blaze.remains&action.conflagrate.charges<2))
G 9.03 immolate,if=talent.roaring_blaze.enabled&remains<=duration&!debuff.roaring_blaze.remains&target.time_to_die>10&(action.conflagrate.charges=2+set_bonus.tier19_4pc|(action.conflagrate.charges>=1+set_bonus.tier19_4pc&action.conflagrate.recharge_time<cast_time+gcd)|target.time_to_die<24)
H 2.07 berserking
0.00 blood_fury
0.00 arcane_torrent
I 1.00 potion,name=deadly_grace,if=(buff.soul_harvest.remains|trinket.proc.any.react|target.time_to_die<=45)
0.00 shadowburn,if=buff.conflagration_of_chaos.remains<=action.chaos_bolt.cast_time
0.00 shadowburn,if=(charges=1&recharge_time<action.chaos_bolt.cast_time|charges=2)&soul_shard<5
J 13.83 conflagrate,if=talent.roaring_blaze.enabled&(charges=2+set_bonus.tier19_4pc|(charges>=1+set_bonus.tier19_4pc&recharge_time<gcd)|target.time_to_die<24)
K 34.47 conflagrate,if=talent.roaring_blaze.enabled&debuff.roaring_blaze.stack>0&dot.immolate.remains>dot.immolate.duration*0.3&(active_enemies=1|soul_shard<3)&soul_shard<5
0.00 conflagrate,if=!talent.roaring_blaze.enabled&!buff.backdraft.remains&buff.conflagration_of_chaos.remains<=action.chaos_bolt.cast_time
0.00 conflagrate,if=!talent.roaring_blaze.enabled&!buff.backdraft.remains&(charges=1&recharge_time<action.chaos_bolt.cast_time|charges=2)&soul_shard<5
0.00 life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<=gcd
L 11.07 dimensional_rift,if=equipped.144369&!buff.lessons_of_spacetime.remains&((!talent.grimoire_of_supremacy.enabled&!cooldown.summon_doomguard.remains)|(talent.grimoire_of_service.enabled&!cooldown.service_pet.remains)|(talent.soul_harvest.enabled&!cooldown.soul_harvest.remains))
M 3.68 service_pet
N 1.00 summon_infernal,if=artifact.lord_of_flames.rank>0&!buff.lord_of_flames.remains
O 1.00 summon_doomguard,if=!talent.grimoire_of_supremacy.enabled&spell_targets.infernal_awakening<=2&(target.time_to_die>180|target.health.pct<=20|target.time_to_die<30)
0.00 summon_infernal,if=!talent.grimoire_of_supremacy.enabled&spell_targets.infernal_awakening>2
0.00 summon_doomguard,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal=1&artifact.lord_of_flames.rank>0&buff.lord_of_flames.remains&!pet.doomguard.active
0.00 summon_doomguard,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal=1&equipped.132379&!cooldown.sindorei_spite_icd.remains
0.00 summon_infernal,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal>1&equipped.132379&!cooldown.sindorei_spite_icd.remains
P 2.89 soul_harvest
0.00 channel_demonfire,if=dot.immolate.remains>cast_time
0.00 havoc,if=active_enemies=1&talent.wreak_havoc.enabled&equipped.132375&!debuff.havoc.remains
0.00 rain_of_fire,if=active_enemies>=3&cooldown.havoc.remains<=12&!talent.wreak_havoc.enabled
0.00 rain_of_fire,if=active_enemies>=6&talent.wreak_havoc.enabled
Q 1.04 dimensional_rift,if=!equipped.144369|charges>1|((!talent.grimoire_of_service.enabled|recharge_time<cooldown.service_pet.remains)&(!talent.soul_harvest.enabled|recharge_time<cooldown.soul_harvest.remains)&(!talent.grimoire_of_supremacy.enabled|recharge_time<cooldown.summon_doomguard.remains))
0.00 life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<duration*0.3
0.00 cataclysm
R 57.76 chaos_bolt,if=(cooldown.havoc.remains>12&cooldown.havoc.remains|active_enemies<3|talent.wreak_havoc.enabled&active_enemies<6)
0.00 shadowburn
0.00 conflagrate,if=!talent.roaring_blaze.enabled&!buff.backdraft.remains
0.00 immolate,if=!talent.roaring_blaze.enabled&remains<=duration*0.3
S 80.57 incinerate
T 7.58 life_tap

Sample Sequence

0126ABCDEGHJMKNLPRKKRSRSKSSLRKCSRSSESSSSSGJKRKRRKSCSSKRLRSSSESSQSCSGJKKRSKRRLSSKSTCSSERSLSMSGJKLRCKKRRRSKRRSRRESTCRPIRSSGJKKRLRKRSCSRKRSSESRRSSTSSSSCGJRKKRKRSRSKLHRSCTESSSMSSSGJKLRKKCRRSSKRTSSSELSRSCSTGJKLOKRRKRSSKCPRSSERSRSSSSRGJRKKCLRRKRSTSJRSMJERCSJRRSSJ

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask Shoulders 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 1 food Shoulders 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 2 summon_imp Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 6 augmentation Shoulders 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat A potion Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard potion_of_prolonged_power
0:00.000 precombat B chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard embrace_chaos, nefarious_pact, accelerando, potion_of_prolonged_power
0:00.000 default C havoc enemy2 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard embrace_chaos, nefarious_pact, accelerando, potion_of_prolonged_power
0:00.797 default D dimensional_rift Fluffy_Pillow 1023509.1/1100000: 93% mana | 1.0/5: 20% soul_shard embrace_chaos, nefarious_pact, accelerando, potion_of_prolonged_power
0:01.593 default E immolate Fluffy_Pillow 1038452.1/1100000: 94% mana | 1.0/5: 20% soul_shard bloodlust, lessons_of_spacetime, embrace_chaos, nefarious_pact, accelerando, potion_of_prolonged_power
0:02.348 default G immolate Fluffy_Pillow 986625.5/1100000: 90% mana | 1.0/5: 20% soul_shard bloodlust, lessons_of_spacetime, embrace_chaos, nefarious_pact, accelerando, potion_of_prolonged_power
0:03.102 default H berserking Fluffy_Pillow 934780.1/1100000: 85% mana | 1.0/5: 20% soul_shard bloodlust, lessons_of_spacetime, embrace_chaos, nefarious_pact, accelerando, potion_of_prolonged_power
0:03.102 default J conflagrate Fluffy_Pillow 934780.1/1100000: 85% mana | 1.0/5: 20% soul_shard bloodlust, berserking, lessons_of_spacetime, embrace_chaos, nefarious_pact, accelerando, potion_of_prolonged_power
0:03.856 default M service_imp Fluffy_Pillow 951057.8/1100000: 86% mana | 3.0/5: 60% soul_shard bloodlust, berserking, lessons_of_spacetime, embrace_chaos, nefarious_pact, accelerando, potion_of_prolonged_power
0:04.612 default K conflagrate Fluffy_Pillow 967378.8/1100000: 88% mana | 2.0/5: 40% soul_shard bloodlust, berserking, lessons_of_spacetime, nefarious_pact, accelerando, potion_of_prolonged_power
0:05.367 default N summon_infernal Fluffy_Pillow 983678.1/1100000: 89% mana | 3.0/5: 60% soul_shard bloodlust, berserking, lessons_of_spacetime, nefarious_pact, accelerando, potion_of_prolonged_power
0:06.121 default L dimensional_rift Fluffy_Pillow 999955.9/1100000: 91% mana | 3.0/5: 60% soul_shard bloodlust, berserking, lord_of_flames, nefarious_pact, accelerando, potion_of_prolonged_power
0:06.875 default P soul_harvest Fluffy_Pillow 1016233.7/1100000: 92% mana | 3.0/5: 60% soul_shard bloodlust, berserking, lessons_of_spacetime, lord_of_flames, nefarious_pact, accelerando, potion_of_prolonged_power
0:06.875 default R chaos_bolt Fluffy_Pillow 1016233.7/1100000: 92% mana | 3.0/5: 60% soul_shard bloodlust, berserking, soul_harvest, lessons_of_spacetime, lord_of_flames, nefarious_pact, accelerando, potion_of_prolonged_power
0:07.937 default K conflagrate Fluffy_Pillow 1039160.7/1100000: 94% mana | 1.0/5: 20% soul_shard bloodlust, berserking, soul_harvest, lessons_of_spacetime, lord_of_flames, embrace_chaos, nefarious_pact, accelerando, potion_of_prolonged_power
0:08.692 default K conflagrate Fluffy_Pillow 1055460.1/1100000: 96% mana | 2.0/5: 40% soul_shard bloodlust, berserking, soul_harvest, lessons_of_spacetime, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando, potion_of_prolonged_power
0:09.446 default R chaos_bolt Fluffy_Pillow 1071980.9/1100000: 97% mana | 3.0/5: 60% soul_shard bloodlust, berserking, soul_harvest, lessons_of_spacetime, lord_of_flames, embrace_chaos, nefarious_pact, accelerando(2), potion_of_prolonged_power
0:10.200 default S incinerate Fluffy_Pillow 1088501.7/1100000: 99% mana | 1.0/5: 20% soul_shard bloodlust, berserking, soul_harvest, lessons_of_spacetime, lord_of_flames, embrace_chaos, nefarious_pact, accelerando(2), potion_of_prolonged_power
0:10.954 default R chaos_bolt Fluffy_Pillow 1036804.6/1100000: 94% mana | 2.0/5: 40% soul_shard bloodlust, berserking, soul_harvest, lessons_of_spacetime, lord_of_flames, embrace_chaos, nefarious_pact, accelerando(2), potion_of_prolonged_power
0:11.707 default S incinerate Fluffy_Pillow 1053303.5/1100000: 96% mana | 0.0/5: 0% soul_shard bloodlust, berserking, soul_harvest, lessons_of_spacetime, lord_of_flames, embrace_chaos, nefarious_pact, accelerando(2), potion_of_prolonged_power
0:12.460 default K conflagrate Fluffy_Pillow 1003506.0/1100000: 91% mana | 0.0/5: 0% soul_shard bloodlust, berserking, soul_harvest, lessons_of_spacetime, lord_of_flames, embrace_chaos, devils_due, potion_of_prolonged_power
0:13.379 default S incinerate Fluffy_Pillow 1022281.7/1100000: 93% mana | 1.0/5: 20% soul_shard bloodlust, soul_harvest, lessons_of_spacetime, lord_of_flames, embrace_chaos, devils_due, potion_of_prolonged_power
0:14.645 default S incinerate Fluffy_Pillow 979693.6/1100000: 89% mana | 1.0/5: 20% soul_shard bloodlust, soul_harvest, lessons_of_spacetime, lord_of_flames, embrace_chaos, devils_due, potion_of_prolonged_power
0:15.910 default L dimensional_rift Fluffy_Pillow 937088.0/1100000: 85% mana | 2.0/5: 40% soul_shard bloodlust, soul_harvest, lord_of_flames, devils_due, accelerando, potion_of_prolonged_power
0:16.951 default R chaos_bolt Fluffy_Pillow 956630.4/1100000: 87% mana | 2.0/5: 40% soul_shard bloodlust, soul_harvest, lessons_of_spacetime, lord_of_flames, devils_due, accelerando, potion_of_prolonged_power
0:19.027 default K conflagrate Fluffy_Pillow 995641.9/1100000: 91% mana | 0.0/5: 0% soul_shard bloodlust, soul_harvest, lessons_of_spacetime, lord_of_flames, embrace_chaos, devils_due, accelerando(2), potion_of_prolonged_power
0:20.051 default C havoc enemy2 1015152.1/1100000: 92% mana | 1.0/5: 20% soul_shard bloodlust, soul_harvest, lessons_of_spacetime, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2), potion_of_prolonged_power
0:20.920 default S incinerate Fluffy_Pillow 943709.1/1100000: 86% mana | 1.0/5: 20% soul_shard bloodlust, soul_harvest, lessons_of_spacetime, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2), potion_of_prolonged_power
0:21.963 default R chaos_bolt Fluffy_Pillow 897581.4/1100000: 82% mana | 2.0/5: 40% soul_shard bloodlust, soul_harvest, lessons_of_spacetime, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2), potion_of_prolonged_power
0:23.006 default S incinerate Fluffy_Pillow 917551.0/1100000: 83% mana | 0.0/5: 0% soul_shard bloodlust, soul_harvest, lessons_of_spacetime, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3), potion_of_prolonged_power
0:24.035 default S incinerate Fluffy_Pillow 871444.5/1100000: 79% mana | 0.0/5: 0% soul_shard bloodlust, soul_harvest, lessons_of_spacetime, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3), potion_of_prolonged_power
0:25.065 default E immolate Fluffy_Pillow 825357.3/1100000: 75% mana | 1.0/5: 20% soul_shard bloodlust, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3), potion_of_prolonged_power
0:25.923 default S incinerate Fluffy_Pillow 775946.3/1100000: 71% mana | 1.0/5: 20% soul_shard bloodlust, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(4), potion_of_prolonged_power
0:26.933 default S incinerate Fluffy_Pillow 729755.5/1100000: 66% mana | 1.0/5: 20% soul_shard bloodlust, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(4), potion_of_prolonged_power
0:27.946 default S incinerate Fluffy_Pillow 683578.8/1100000: 62% mana | 1.0/5: 20% soul_shard bloodlust, lord_of_flames, conflagration_of_chaos, potion_of_prolonged_power
0:29.020 default S incinerate Fluffy_Pillow 637440.0/1100000: 58% mana | 1.0/5: 20% soul_shard bloodlust, lord_of_flames, conflagration_of_chaos, potion_of_prolonged_power
0:30.095 default S incinerate Fluffy_Pillow 591319.7/1100000: 54% mana | 1.0/5: 20% soul_shard bloodlust, lord_of_flames, conflagration_of_chaos, potion_of_prolonged_power
0:31.170 default G immolate Fluffy_Pillow 545199.4/1100000: 50% mana | 1.0/5: 20% soul_shard bloodlust, lord_of_flames, conflagration_of_chaos, potion_of_prolonged_power
0:32.067 default J conflagrate Fluffy_Pillow 495788.9/1100000: 45% mana | 1.0/5: 20% soul_shard bloodlust, lord_of_flames, conflagration_of_chaos, accelerando, potion_of_prolonged_power
0:32.949 default K conflagrate Fluffy_Pillow 512346.3/1100000: 47% mana | 2.0/5: 40% soul_shard bloodlust, lord_of_flames, conflagration_of_chaos, accelerando, potion_of_prolonged_power
0:33.831 default R chaos_bolt Fluffy_Pillow 528903.8/1100000: 48% mana | 3.0/5: 60% soul_shard bloodlust, lord_of_flames, conflagration_of_chaos, accelerando, potion_of_prolonged_power
0:35.593 default K conflagrate Fluffy_Pillow 561981.2/1100000: 51% mana | 2.0/5: 40% soul_shard bloodlust, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando, potion_of_prolonged_power
0:36.478 default R chaos_bolt Fluffy_Pillow 578595.1/1100000: 53% mana | 3.0/5: 60% soul_shard bloodlust, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando, potion_of_prolonged_power
0:37.535 default R chaos_bolt Fluffy_Pillow 598438.6/1100000: 54% mana | 2.0/5: 40% soul_shard bloodlust, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2), potion_of_prolonged_power
0:38.579 default K conflagrate Fluffy_Pillow 618329.9/1100000: 56% mana | 0.0/5: 0% soul_shard bloodlust, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2), potion_of_prolonged_power
0:39.449 default S incinerate Fluffy_Pillow 634905.9/1100000: 58% mana | 1.0/5: 20% soul_shard bloodlust, lord_of_flames, embrace_chaos, accelerando(2), potion_of_prolonged_power
0:40.494 default C havoc enemy2 588816.2/1100000: 54% mana | 1.0/5: 20% soul_shard bloodlust, lord_of_flames, embrace_chaos, accelerando(2), potion_of_prolonged_power
0:41.364 default S incinerate Fluffy_Pillow 513567.1/1100000: 47% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando(2), potion_of_prolonged_power
0:42.718 default S incinerate Fluffy_Pillow 467411.4/1100000: 42% mana | 1.0/5: 20% soul_shard lord_of_flames, accelerando(2), potion_of_prolonged_power
0:44.073 default K conflagrate Fluffy_Pillow 421265.7/1100000: 38% mana | 1.0/5: 20% soul_shard lord_of_flames, potion_of_prolonged_power
0:45.275 default R chaos_bolt Fluffy_Pillow 438364.4/1100000: 40% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, potion_of_prolonged_power
0:47.598 default L dimensional_rift Fluffy_Pillow 471696.5/1100000: 43% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando, potion_of_prolonged_power
0:48.746 default R chaos_bolt Fluffy_Pillow 488274.2/1100000: 44% mana | 2.0/5: 40% soul_shard lessons_of_spacetime, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando, potion_of_prolonged_power
0:50.121 default S incinerate Fluffy_Pillow 508129.9/1100000: 46% mana | 0.0/5: 0% soul_shard lessons_of_spacetime, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando, potion_of_prolonged_power
0:51.494 default S incinerate Fluffy_Pillow 461956.8/1100000: 42% mana | 0.0/5: 0% soul_shard lessons_of_spacetime, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando, potion_of_prolonged_power
0:52.869 default S incinerate Fluffy_Pillow 415812.4/1100000: 38% mana | 0.0/5: 0% soul_shard lessons_of_spacetime, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando, potion_of_prolonged_power
0:54.242 default E immolate Fluffy_Pillow 369639.3/1100000: 34% mana | 0.0/5: 0% soul_shard lessons_of_spacetime, lord_of_flames, conflagration_of_chaos, accelerando, potion_of_prolonged_power
0:55.387 default S incinerate Fluffy_Pillow 320173.6/1100000: 29% mana | 0.0/5: 0% soul_shard lessons_of_spacetime, lord_of_flames, conflagration_of_chaos, accelerando, potion_of_prolonged_power
0:56.763 default S incinerate Fluffy_Pillow 274044.9/1100000: 25% mana | 0.0/5: 0% soul_shard lessons_of_spacetime, lord_of_flames, conflagration_of_chaos, accelerando(2), potion_of_prolonged_power
0:58.117 default Q dimensional_rift Fluffy_Pillow 227889.2/1100000: 21% mana | 0.0/5: 0% soul_shard lessons_of_spacetime, lord_of_flames, conflagration_of_chaos, accelerando(2)
0:59.247 default S incinerate Fluffy_Pillow 244027.5/1100000: 22% mana | 0.0/5: 0% soul_shard lessons_of_spacetime, lord_of_flames, conflagration_of_chaos
1:00.644 default C havoc enemy2 198050.4/1100000: 18% mana | 0.0/5: 0% soul_shard lessons_of_spacetime, lord_of_flames, conflagration_of_chaos, accelerando
1:01.790 default S incinerate Fluffy_Pillow 126599.2/1100000: 12% mana | 0.0/5: 0% soul_shard lessons_of_spacetime, lord_of_flames, conflagration_of_chaos, accelerando
1:03.165 default G immolate Fluffy_Pillow 80455.7/1100000: 7% mana | 0.0/5: 0% soul_shard lessons_of_spacetime, lord_of_flames, conflagration_of_chaos, accelerando(2)
1:04.293 default J conflagrate Fluffy_Pillow 30987.8/1100000: 3% mana | 0.0/5: 0% soul_shard lessons_of_spacetime, lord_of_flames, accelerando(2)
1:05.422 default K conflagrate Fluffy_Pillow 47534.6/1100000: 4% mana | 1.0/5: 20% soul_shard lessons_of_spacetime, lord_of_flames, conflagration_of_chaos, accelerando(2)
1:06.550 default K conflagrate Fluffy_Pillow 64066.7/1100000: 6% mana | 2.0/5: 40% soul_shard lessons_of_spacetime, lord_of_flames, conflagration_of_chaos, accelerando(2)
1:07.679 default R chaos_bolt Fluffy_Pillow 80856.5/1100000: 7% mana | 3.0/5: 60% soul_shard lessons_of_spacetime, lord_of_flames, conflagration_of_chaos, accelerando(3)
1:09.902 default S incinerate Fluffy_Pillow 114106.9/1100000: 10% mana | 1.0/5: 20% soul_shard lessons_of_spacetime, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(4)
1:11.217 default K conflagrate Fluffy_Pillow 67946.3/1100000: 6% mana | 1.0/5: 20% soul_shard lessons_of_spacetime, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(4)
1:12.455 default R chaos_bolt Fluffy_Pillow 86185.4/1100000: 8% mana | 2.0/5: 40% soul_shard lessons_of_spacetime, lord_of_flames, conflagration_of_chaos, embrace_chaos
1:13.852 default R chaos_bolt Fluffy_Pillow 106156.6/1100000: 10% mana | 2.0/5: 40% soul_shard lessons_of_spacetime, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
1:15.226 default L dimensional_rift Fluffy_Pillow 125997.8/1100000: 11% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
1:16.373 default S incinerate Fluffy_Pillow 142561.1/1100000: 13% mana | 0.0/5: 0% soul_shard lessons_of_spacetime, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
1:17.750 default S incinerate Fluffy_Pillow 96445.7/1100000: 9% mana | 0.0/5: 0% soul_shard lessons_of_spacetime, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
1:19.125 default K conflagrate Fluffy_Pillow 50301.4/1100000: 5% mana | 0.0/5: 0% soul_shard lessons_of_spacetime, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
1:20.272 default S incinerate Fluffy_Pillow 66864.6/1100000: 6% mana | 1.0/5: 20% soul_shard lessons_of_spacetime, lord_of_flames, conflagration_of_chaos, accelerando
1:21.649 default T life_tap Fluffy_Pillow 20749.2/1100000: 2% mana | 1.0/5: 20% soul_shard lessons_of_spacetime, lord_of_flames, conflagration_of_chaos, accelerando
1:22.795 default C havoc enemy2 367348.5/1100000: 33% mana | 1.0/5: 20% soul_shard lessons_of_spacetime, lord_of_flames, conflagration_of_chaos, accelerando(2)
1:23.924 default S incinerate Fluffy_Pillow 295895.2/1100000: 27% mana | 1.0/5: 20% soul_shard lessons_of_spacetime, lord_of_flames, conflagration_of_chaos, accelerando(2)
1:25.279 default S incinerate Fluffy_Pillow 249754.2/1100000: 23% mana | 1.0/5: 20% soul_shard lessons_of_spacetime, lord_of_flames, conflagration_of_chaos, accelerando(2)
1:26.633 default E immolate Fluffy_Pillow 203064.7/1100000: 18% mana | 1.0/5: 20% soul_shard lessons_of_spacetime, lord_of_flames, conflagration_of_chaos
1:27.797 default R chaos_bolt Fluffy_Pillow 153622.9/1100000: 14% mana | 2.0/5: 40% soul_shard lessons_of_spacetime, lord_of_flames, conflagration_of_chaos
1:30.119 default S incinerate Fluffy_Pillow 186655.5/1100000: 17% mana | 0.0/5: 0% soul_shard lessons_of_spacetime, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
1:31.495 default L dimensional_rift Fluffy_Pillow 140525.6/1100000: 13% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
1:32.642 default S incinerate Fluffy_Pillow 157088.9/1100000: 14% mana | 1.0/5: 20% soul_shard lessons_of_spacetime, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
1:34.017 default M service_imp Fluffy_Pillow 110944.6/1100000: 10% mana | 1.0/5: 20% soul_shard lessons_of_spacetime, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
1:35.164 default S incinerate Fluffy_Pillow 127507.9/1100000: 12% mana | 0.0/5: 0% soul_shard lessons_of_spacetime, lord_of_flames, conflagration_of_chaos, accelerando
1:36.538 default G immolate Fluffy_Pillow 81349.8/1100000: 7% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, accelerando(2)
1:37.668 default J conflagrate Fluffy_Pillow 31911.2/1100000: 3% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, accelerando(2)
1:38.797 default K conflagrate Fluffy_Pillow 48457.9/1100000: 4% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, accelerando(2)
1:39.925 default L dimensional_rift Fluffy_Pillow 64990.0/1100000: 6% mana | 3.0/5: 60% soul_shard lord_of_flames, accelerando(2)
1:41.055 default R chaos_bolt Fluffy_Pillow 81794.7/1100000: 7% mana | 3.0/5: 60% soul_shard lessons_of_spacetime, lord_of_flames, accelerando(3)
1:43.278 default C havoc enemy2 114238.3/1100000: 10% mana | 1.0/5: 20% soul_shard lessons_of_spacetime, lord_of_flames, embrace_chaos
1:44.440 default K conflagrate Fluffy_Pillow 42768.0/1100000: 4% mana | 1.0/5: 20% soul_shard lessons_of_spacetime, lord_of_flames, embrace_chaos
1:45.602 default K conflagrate Fluffy_Pillow 59297.7/1100000: 5% mana | 2.0/5: 40% soul_shard lessons_of_spacetime, lord_of_flames, conflagration_of_chaos, embrace_chaos
1:46.764 default R chaos_bolt Fluffy_Pillow 76077.6/1100000: 7% mana | 4.0/5: 80% soul_shard lessons_of_spacetime, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
1:48.140 default R chaos_bolt Fluffy_Pillow 95947.7/1100000: 9% mana | 3.0/5: 60% soul_shard lessons_of_spacetime, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
1:49.515 default R chaos_bolt Fluffy_Pillow 115804.3/1100000: 11% mana | 2.0/5: 40% soul_shard lessons_of_spacetime, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
1:50.869 default S incinerate Fluffy_Pillow 135711.7/1100000: 12% mana | 1.0/5: 20% soul_shard lessons_of_spacetime, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
1:52.204 default K conflagrate Fluffy_Pillow 89565.9/1100000: 8% mana | 1.0/5: 20% soul_shard lessons_of_spacetime, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(4)
1:53.301 default R chaos_bolt Fluffy_Pillow 106116.4/1100000: 10% mana | 4.0/5: 80% soul_shard lessons_of_spacetime, lord_of_flames, embrace_chaos, accelerando(4)
1:54.617 default R chaos_bolt Fluffy_Pillow 125970.9/1100000: 11% mana | 2.0/5: 40% soul_shard lessons_of_spacetime, lord_of_flames, embrace_chaos, accelerando(4)
1:55.936 default S incinerate Fluffy_Pillow 145870.7/1100000: 13% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando(4)
1:57.252 default R chaos_bolt Fluffy_Pillow 99742.6/1100000: 9% mana | 3.0/5: 60% soul_shard lord_of_flames, embrace_chaos, accelerando(5)
1:58.549 default R chaos_bolt Fluffy_Pillow 118570.5/1100000: 11% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando
1:59.925 default E immolate Fluffy_Pillow 138564.2/1100000: 13% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos, accelerando(3)
2:01.037 default S incinerate Fluffy_Pillow 89101.2/1100000: 8% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos, accelerando(3)
2:02.373 default T life_tap Fluffy_Pillow 42969.4/1100000: 4% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando(3)
2:03.485 default C havoc enemy2 389506.4/1100000: 35% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando(3)
2:04.599 default R chaos_bolt Fluffy_Pillow 318073.2/1100000: 29% mana | 2.0/5: 40% soul_shard lord_of_flames, accelerando(3)
2:06.822 default P soul_harvest Fluffy_Pillow 351132.4/1100000: 32% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando(3)
2:06.875 default I potion Fluffy_Pillow 351920.5/1100000: 32% mana | 2.0/5: 40% soul_shard soul_harvest, lord_of_flames, embrace_chaos, accelerando(3)
2:06.875 default R chaos_bolt Fluffy_Pillow 351920.5/1100000: 32% mana | 2.0/5: 40% soul_shard soul_harvest, lord_of_flames, embrace_chaos, accelerando(3), potion_of_deadly_grace
2:08.209 default S incinerate Fluffy_Pillow 371759.0/1100000: 34% mana | 0.0/5: 0% soul_shard soul_harvest, lord_of_flames, embrace_chaos, accelerando(3), potion_of_deadly_grace
2:09.544 default S incinerate Fluffy_Pillow 325613.2/1100000: 30% mana | 0.0/5: 0% soul_shard soul_harvest, lord_of_flames, embrace_chaos, accelerando(4), potion_of_deadly_grace
2:10.861 default G immolate Fluffy_Pillow 279210.5/1100000: 25% mana | 0.0/5: 0% soul_shard soul_harvest, lord_of_flames, embrace_chaos, potion_of_deadly_grace
2:12.023 default J conflagrate Fluffy_Pillow 229740.1/1100000: 21% mana | 0.0/5: 0% soul_shard soul_harvest, lord_of_flames, embrace_chaos, potion_of_deadly_grace
2:13.188 default K conflagrate Fluffy_Pillow 246312.5/1100000: 22% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, potion_of_deadly_grace
2:14.350 default K conflagrate Fluffy_Pillow 262842.2/1100000: 24% mana | 2.0/5: 40% soul_shard soul_harvest, lord_of_flames, potion_of_deadly_grace
2:15.514 default R chaos_bolt Fluffy_Pillow 279400.3/1100000: 25% mana | 3.0/5: 60% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, potion_of_deadly_grace
2:17.838 default L dimensional_rift Fluffy_Pillow 312690.9/1100000: 28% mana | 2.0/5: 40% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando, potion_of_deadly_grace
2:18.983 default R chaos_bolt Fluffy_Pillow 329225.3/1100000: 30% mana | 2.0/5: 40% soul_shard soul_harvest, lessons_of_spacetime, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando, potion_of_deadly_grace
2:20.358 default K conflagrate Fluffy_Pillow 349081.0/1100000: 32% mana | 1.0/5: 20% soul_shard soul_harvest, lessons_of_spacetime, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando, potion_of_deadly_grace
2:21.503 default R chaos_bolt Fluffy_Pillow 365615.4/1100000: 33% mana | 2.0/5: 40% soul_shard soul_harvest, lessons_of_spacetime, lord_of_flames, embrace_chaos, accelerando, potion_of_deadly_grace
2:22.879 default S incinerate Fluffy_Pillow 385486.6/1100000: 35% mana | 0.0/5: 0% soul_shard soul_harvest, lessons_of_spacetime, lord_of_flames, embrace_chaos, accelerando(2), potion_of_deadly_grace
2:24.235 default C havoc enemy2 339494.2/1100000: 31% mana | 1.0/5: 20% soul_shard soul_harvest, lessons_of_spacetime, lord_of_flames, embrace_chaos, accelerando(4), potion_of_deadly_grace
2:25.330 default S incinerate Fluffy_Pillow 268014.5/1100000: 24% mana | 1.0/5: 20% soul_shard soul_harvest, lessons_of_spacetime, lord_of_flames, embrace_chaos, accelerando(4), potion_of_deadly_grace
2:26.646 default R chaos_bolt Fluffy_Pillow 221869.0/1100000: 20% mana | 3.0/5: 60% soul_shard lessons_of_spacetime, lord_of_flames, embrace_chaos, accelerando(4), potion_of_deadly_grace
2:27.962 default K conflagrate Fluffy_Pillow 241723.5/1100000: 22% mana | 1.0/5: 20% soul_shard lessons_of_spacetime, lord_of_flames, embrace_chaos, accelerando(4), potion_of_deadly_grace
2:29.060 default R chaos_bolt Fluffy_Pillow 258033.9/1100000: 23% mana | 2.0/5: 40% soul_shard lessons_of_spacetime, lord_of_flames, embrace_chaos, potion_of_deadly_grace
2:30.454 default S incinerate Fluffy_Pillow 277909.1/1100000: 25% mana | 1.0/5: 20% soul_shard lessons_of_spacetime, lord_of_flames, embrace_chaos, accelerando, potion_of_deadly_grace
2:31.830 default S incinerate Fluffy_Pillow 231780.3/1100000: 21% mana | 1.0/5: 20% soul_shard lessons_of_spacetime, lord_of_flames, embrace_chaos, accelerando(2), potion_of_deadly_grace
2:33.184 default E immolate Fluffy_Pillow 185625.5/1100000: 17% mana | 1.0/5: 20% soul_shard lessons_of_spacetime, lord_of_flames, embrace_chaos, accelerando(3), potion_of_deadly_grace
2:34.297 default S incinerate Fluffy_Pillow 136177.4/1100000: 12% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando(3), potion_of_deadly_grace
2:35.632 default R chaos_bolt Fluffy_Pillow 90030.7/1100000: 8% mana | 2.0/5: 40% soul_shard lord_of_flames, nefarious_pact, accelerando(3), potion_of_deadly_grace
2:37.173 default R chaos_bolt Fluffy_Pillow 112948.5/1100000: 10% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, nefarious_pact, accelerando(4)
2:38.086 default S incinerate Fluffy_Pillow 126765.5/1100000: 12% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos, nefarious_pact, accelerando(5)
2:38.987 default S incinerate Fluffy_Pillow 74552.9/1100000: 7% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos, nefarious_pact, accelerando(5)
2:39.888 default T life_tap Fluffy_Pillow 22340.3/1100000: 2% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos, nefarious_pact, accelerando(5)
2:40.642 default S incinerate Fluffy_Pillow 363878.3/1100000: 33% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos, nefarious_pact, accelerando(5)
2:41.544 default S incinerate Fluffy_Pillow 311681.0/1100000: 28% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos, nefarious_pact, accelerando(5)
2:42.442 default S incinerate Fluffy_Pillow 259209.2/1100000: 24% mana | 0.0/5: 0% soul_shard lord_of_flames, nefarious_pact
2:43.413 default S incinerate Fluffy_Pillow 207021.8/1100000: 19% mana | 1.0/5: 20% soul_shard lord_of_flames, nefarious_pact
2:44.381 default C havoc enemy2 154791.8/1100000: 14% mana | 1.0/5: 20% soul_shard lord_of_flames, nefarious_pact
2:45.188 default G immolate Fluffy_Pillow 78271.6/1100000: 7% mana | 2.0/5: 40% soul_shard lord_of_flames, nefarious_pact
2:45.995 default J conflagrate Fluffy_Pillow 23751.3/1100000: 2% mana | 2.0/5: 40% soul_shard lord_of_flames, nefarious_pact
2:46.801 default R chaos_bolt Fluffy_Pillow 35216.8/1100000: 3% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, devils_due
2:49.538 default K conflagrate Fluffy_Pillow 74516.6/1100000: 7% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due, accelerando
2:50.887 default K conflagrate Fluffy_Pillow 93996.8/1100000: 9% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due, accelerando
2:52.236 default R chaos_bolt Fluffy_Pillow 113477.1/1100000: 10% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due, accelerando
2:53.856 default K conflagrate Fluffy_Pillow 136997.9/1100000: 12% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due, accelerando(2)
2:55.187 default R chaos_bolt Fluffy_Pillow 156505.2/1100000: 14% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
2:56.542 default S incinerate Fluffy_Pillow 176625.3/1100000: 16% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
2:57.879 default R chaos_bolt Fluffy_Pillow 130508.4/1100000: 12% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
2:59.214 default S incinerate Fluffy_Pillow 150361.8/1100000: 14% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
3:00.550 default K conflagrate Fluffy_Pillow 103771.8/1100000: 9% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
3:01.714 default L dimensional_rift Fluffy_Pillow 120329.9/1100000: 11% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
3:02.877 default H berserking Fluffy_Pillow 137124.2/1100000: 12% mana | 2.0/5: 40% soul_shard lessons_of_spacetime, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
3:03.102 default R chaos_bolt Fluffy_Pillow 140373.4/1100000: 13% mana | 2.0/5: 40% soul_shard berserking, lessons_of_spacetime, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
3:04.300 default S incinerate Fluffy_Pillow 160268.0/1100000: 15% mana | 0.0/5: 0% soul_shard berserking, lessons_of_spacetime, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
3:05.497 default C havoc enemy2 114147.4/1100000: 10% mana | 0.0/5: 0% soul_shard berserking, lessons_of_spacetime, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
3:06.480 default T life_tap Fluffy_Pillow 42715.4/1100000: 4% mana | 0.0/5: 0% soul_shard berserking, lessons_of_spacetime, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
3:07.462 default E immolate Fluffy_Pillow 389266.5/1100000: 35% mana | 0.0/5: 0% soul_shard berserking, lessons_of_spacetime, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
3:08.444 default S incinerate Fluffy_Pillow 339817.6/1100000: 31% mana | 0.0/5: 0% soul_shard berserking, lessons_of_spacetime, lord_of_flames, conflagration_of_chaos, accelerando(2)
3:09.622 default S incinerate Fluffy_Pillow 293672.3/1100000: 27% mana | 0.0/5: 0% soul_shard berserking, lessons_of_spacetime, lord_of_flames, conflagration_of_chaos, accelerando(2)
3:10.800 default S incinerate Fluffy_Pillow 247527.9/1100000: 23% mana | 0.0/5: 0% soul_shard berserking, lessons_of_spacetime, lord_of_flames, conflagration_of_chaos, accelerando(3)
3:11.962 default M service_imp Fluffy_Pillow 201552.8/1100000: 18% mana | 1.0/5: 20% soul_shard berserking, lessons_of_spacetime, lord_of_flames, conflagration_of_chaos, accelerando(4)
3:12.917 default S incinerate Fluffy_Pillow 218143.6/1100000: 20% mana | 0.0/5: 0% soul_shard berserking, lessons_of_spacetime, lord_of_flames, conflagration_of_chaos, accelerando(5)
3:14.046 default S incinerate Fluffy_Pillow 169487.0/1100000: 15% mana | 0.0/5: 0% soul_shard lessons_of_spacetime, lord_of_flames, conflagration_of_chaos
3:15.442 default S incinerate Fluffy_Pillow 123347.3/1100000: 11% mana | 0.0/5: 0% soul_shard lessons_of_spacetime, lord_of_flames, conflagration_of_chaos, accelerando
3:16.817 default G immolate Fluffy_Pillow 77203.0/1100000: 7% mana | 0.0/5: 0% soul_shard lessons_of_spacetime, lord_of_flames, conflagration_of_chaos, accelerando
3:17.962 default J conflagrate Fluffy_Pillow 27737.4/1100000: 3% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, accelerando
3:19.108 default K conflagrate Fluffy_Pillow 44286.2/1100000: 4% mana | 1.0/5: 20% soul_shard lord_of_flames, accelerando
3:20.255 default L dimensional_rift Fluffy_Pillow 60849.5/1100000: 6% mana | 3.0/5: 60% soul_shard lord_of_flames, accelerando
3:21.402 default R chaos_bolt Fluffy_Pillow 77412.7/1100000: 7% mana | 3.0/5: 60% soul_shard lessons_of_spacetime, lord_of_flames, accelerando
3:23.691 default K conflagrate Fluffy_Pillow 110467.1/1100000: 10% mana | 1.0/5: 20% soul_shard lessons_of_spacetime, lord_of_flames, embrace_chaos, accelerando
3:24.838 default K conflagrate Fluffy_Pillow 127030.3/1100000: 12% mana | 2.0/5: 40% soul_shard lessons_of_spacetime, lord_of_flames, embrace_chaos, accelerando
3:26.177 default C havoc enemy2 146366.2/1100000: 13% mana | 3.0/5: 60% soul_shard lessons_of_spacetime, lord_of_flames, embrace_chaos, accelerando
3:27.323 default R chaos_bolt Fluffy_Pillow 75162.1/1100000: 7% mana | 4.0/5: 80% soul_shard lessons_of_spacetime, lord_of_flames, embrace_chaos, accelerando(2)
3:28.677 default R chaos_bolt Fluffy_Pillow 94521.0/1100000: 9% mana | 2.0/5: 40% soul_shard lessons_of_spacetime, lord_of_flames, embrace_chaos, accelerando
3:30.051 default S incinerate Fluffy_Pillow 114558.0/1100000: 10% mana | 0.0/5: 0% soul_shard lessons_of_spacetime, lord_of_flames, embrace_chaos, accelerando(2)
3:31.405 default S incinerate Fluffy_Pillow 68541.0/1100000: 6% mana | 0.0/5: 0% soul_shard lessons_of_spacetime, lord_of_flames, embrace_chaos, accelerando(3)
3:32.741 default K conflagrate Fluffy_Pillow 22410.3/1100000: 2% mana | 0.0/5: 0% soul_shard lessons_of_spacetime, lord_of_flames, embrace_chaos, accelerando(4)
3:33.838 default R chaos_bolt Fluffy_Pillow 38960.8/1100000: 4% mana | 2.0/5: 40% soul_shard lessons_of_spacetime, lord_of_flames, embrace_chaos, accelerando(4)
3:35.155 default T life_tap Fluffy_Pillow 58830.4/1100000: 5% mana | 0.0/5: 0% soul_shard lessons_of_spacetime, lord_of_flames, embrace_chaos, accelerando(4)
3:36.253 default S incinerate Fluffy_Pillow 405395.9/1100000: 37% mana | 1.0/5: 20% soul_shard lessons_of_spacetime, lord_of_flames, embrace_chaos, accelerando(4)
3:37.569 default S incinerate Fluffy_Pillow 359250.4/1100000: 33% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando(4)
3:38.886 default S incinerate Fluffy_Pillow 313120.0/1100000: 28% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando(4)
3:40.203 default E immolate Fluffy_Pillow 266989.6/1100000: 24% mana | 1.0/5: 20% soul_shard lord_of_flames, accelerando(4)
3:41.302 default L dimensional_rift Fluffy_Pillow 216829.1/1100000: 20% mana | 1.0/5: 20% soul_shard lord_of_flames
3:42.467 default S incinerate Fluffy_Pillow 233401.4/1100000: 21% mana | 1.0/5: 20% soul_shard lessons_of_spacetime, lord_of_flames
3:43.864 default R chaos_bolt Fluffy_Pillow 187314.1/1100000: 17% mana | 2.0/5: 40% soul_shard lessons_of_spacetime, lord_of_flames, accelerando
3:46.153 default S incinerate Fluffy_Pillow 220368.4/1100000: 20% mana | 1.0/5: 20% soul_shard lessons_of_spacetime, lord_of_flames, embrace_chaos, accelerando
3:47.528 default C havoc enemy2 174225.0/1100000: 16% mana | 1.0/5: 20% soul_shard lessons_of_spacetime, lord_of_flames, embrace_chaos, accelerando(2)
3:48.658 default S incinerate Fluffy_Pillow 102786.4/1100000: 9% mana | 1.0/5: 20% soul_shard lessons_of_spacetime, lord_of_flames, embrace_chaos, accelerando(2)
3:50.012 default T life_tap Fluffy_Pillow 56630.7/1100000: 5% mana | 1.0/5: 20% soul_shard lessons_of_spacetime, lord_of_flames, embrace_chaos, accelerando(2)
3:51.142 default G immolate Fluffy_Pillow 403192.1/1100000: 37% mana | 1.0/5: 20% soul_shard lord_of_flames, accelerando(2)
3:52.272 default J conflagrate Fluffy_Pillow 353753.5/1100000: 32% mana | 1.0/5: 20% soul_shard lord_of_flames, accelerando(2)
3:53.400 default K conflagrate Fluffy_Pillow 370285.6/1100000: 34% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, accelerando(2)
3:54.529 default L dimensional_rift Fluffy_Pillow 386832.4/1100000: 35% mana | 3.0/5: 60% soul_shard lord_of_flames, accelerando(2)
3:55.660 default O summon_doomguard Fluffy_Pillow 403408.4/1100000: 37% mana | 3.0/5: 60% soul_shard lessons_of_spacetime, lord_of_flames, accelerando(2)
3:56.790 default K conflagrate Fluffy_Pillow 419490.7/1100000: 38% mana | 2.0/5: 40% soul_shard lessons_of_spacetime, lord_of_flames
3:57.953 default R chaos_bolt Fluffy_Pillow 436185.5/1100000: 40% mana | 5.0/5: 100% soul_shard lessons_of_spacetime, lord_of_flames, conflagration_of_chaos, accelerando
4:00.241 default R chaos_bolt Fluffy_Pillow 469225.4/1100000: 43% mana | 3.0/5: 60% soul_shard lessons_of_spacetime, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
4:01.616 default K conflagrate Fluffy_Pillow 489081.1/1100000: 44% mana | 1.0/5: 20% soul_shard lessons_of_spacetime, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
4:02.763 default R chaos_bolt Fluffy_Pillow 505644.3/1100000: 46% mana | 3.0/5: 60% soul_shard lessons_of_spacetime, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
4:04.140 default S incinerate Fluffy_Pillow 525528.9/1100000: 48% mana | 1.0/5: 20% soul_shard lessons_of_spacetime, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
4:05.515 default S incinerate Fluffy_Pillow 479385.5/1100000: 44% mana | 1.0/5: 20% soul_shard lessons_of_spacetime, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
4:06.871 default K conflagrate Fluffy_Pillow 433259.1/1100000: 39% mana | 1.0/5: 20% soul_shard lessons_of_spacetime, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
4:08.002 default C havoc enemy2 449835.2/1100000: 41% mana | 2.0/5: 40% soul_shard lessons_of_spacetime, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
4:09.131 default P soul_harvest Fluffy_Pillow 378625.0/1100000: 34% mana | 2.0/5: 40% soul_shard lessons_of_spacetime, lord_of_flames, conflagration_of_chaos, accelerando(3)
4:09.131 default R chaos_bolt Fluffy_Pillow 378625.0/1100000: 34% mana | 2.0/5: 40% soul_shard soul_harvest, lessons_of_spacetime, lord_of_flames, conflagration_of_chaos, accelerando(3)
4:11.356 default S incinerate Fluffy_Pillow 410453.3/1100000: 37% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
4:12.731 default S incinerate Fluffy_Pillow 364309.0/1100000: 33% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
4:14.107 default E immolate Fluffy_Pillow 318179.2/1100000: 29% mana | 2.0/5: 40% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
4:15.252 default R chaos_bolt Fluffy_Pillow 268714.2/1100000: 24% mana | 2.0/5: 40% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
4:16.607 default S incinerate Fluffy_Pillow 288574.3/1100000: 26% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
4:17.941 default R chaos_bolt Fluffy_Pillow 242412.8/1100000: 22% mana | 2.0/5: 40% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
4:19.277 default S incinerate Fluffy_Pillow 262282.0/1100000: 24% mana | 0.0/5: 0% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(4)
4:20.594 default S incinerate Fluffy_Pillow 216293.3/1100000: 20% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(5)
4:21.891 default S incinerate Fluffy_Pillow 170140.4/1100000: 15% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(5)
4:23.188 default S incinerate Fluffy_Pillow 123673.0/1100000: 11% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact
4:24.157 default R chaos_bolt Fluffy_Pillow 71457.2/1100000: 6% mana | 2.0/5: 40% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, nefarious_pact
4:25.769 default G immolate Fluffy_Pillow 94388.2/1100000: 9% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact
4:26.576 default J conflagrate Fluffy_Pillow 39868.0/1100000: 4% mana | 2.0/5: 40% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact
4:27.384 default R chaos_bolt Fluffy_Pillow 51361.9/1100000: 5% mana | 3.0/5: 60% soul_shard soul_harvest, lord_of_flames, embrace_chaos, nefarious_pact
4:28.351 default K conflagrate Fluffy_Pillow 65117.7/1100000: 6% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, nefarious_pact
4:29.158 default K conflagrate Fluffy_Pillow 76597.5/1100000: 7% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact
4:29.965 default C havoc enemy2 88077.2/1100000: 8% mana | 3.0/5: 60% soul_shard lord_of_flames, embrace_chaos, nefarious_pact
4:30.773 default L dimensional_rift Fluffy_Pillow 11585.4/1100000: 1% mana | 4.0/5: 80% soul_shard lord_of_flames, embrace_chaos, nefarious_pact, accelerando
4:31.594 default R chaos_bolt Fluffy_Pillow 23441.0/1100000: 2% mana | 4.0/5: 80% soul_shard lessons_of_spacetime, lord_of_flames, embrace_chaos, nefarious_pact, accelerando
4:32.548 default R chaos_bolt Fluffy_Pillow 37409.8/1100000: 3% mana | 4.0/5: 80% soul_shard lessons_of_spacetime, lord_of_flames, embrace_chaos, nefarious_pact, accelerando(2)
4:33.488 default K conflagrate Fluffy_Pillow 51186.5/1100000: 5% mana | 2.0/5: 40% soul_shard lessons_of_spacetime, lord_of_flames, embrace_chaos, nefarious_pact, accelerando(2)
4:34.273 default R chaos_bolt Fluffy_Pillow 62691.6/1100000: 6% mana | 3.0/5: 60% soul_shard lessons_of_spacetime, lord_of_flames, embrace_chaos, devils_due, accelerando(2)
4:35.868 default S incinerate Fluffy_Pillow 86068.1/1100000: 8% mana | 1.0/5: 20% soul_shard lessons_of_spacetime, lord_of_flames, embrace_chaos, devils_due, accelerando(2)
4:37.464 default T life_tap Fluffy_Pillow 43459.2/1100000: 4% mana | 1.0/5: 20% soul_shard lessons_of_spacetime, lord_of_flames, embrace_chaos, devils_due, accelerando(2)
4:38.794 default S incinerate Fluffy_Pillow 392951.8/1100000: 36% mana | 1.0/5: 20% soul_shard lessons_of_spacetime, lord_of_flames, embrace_chaos, devils_due, accelerando(2)
4:40.388 default J conflagrate Fluffy_Pillow 350374.8/1100000: 32% mana | 1.0/5: 20% soul_shard lord_of_flames, devils_due, accelerando(3)
4:41.700 default R chaos_bolt Fluffy_Pillow 369886.1/1100000: 34% mana | 2.0/5: 40% soul_shard lord_of_flames, devils_due, accelerando(3)
4:44.319 default S incinerate Fluffy_Pillow 407792.6/1100000: 37% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos
4:45.715 default M service_imp Fluffy_Pillow 361651.0/1100000: 33% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos
4:46.878 default J conflagrate Fluffy_Pillow 378194.9/1100000: 34% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos
4:48.225 default E immolate Fluffy_Pillow 397606.7/1100000: 36% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando
4:49.372 default R chaos_bolt Fluffy_Pillow 348169.9/1100000: 32% mana | 2.0/5: 40% soul_shard lord_of_flames, accelerando
4:51.663 default C havoc enemy2 381254.4/1100000: 35% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos, accelerando(2)
4:52.793 default S incinerate Fluffy_Pillow 309931.2/1100000: 28% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando(3)
4:54.129 default J conflagrate Fluffy_Pillow 263799.4/1100000: 24% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando(3)
4:55.244 default R chaos_bolt Fluffy_Pillow 280381.1/1100000: 25% mana | 3.0/5: 60% soul_shard lord_of_flames, embrace_chaos, accelerando(3)
4:56.577 default R chaos_bolt Fluffy_Pillow 300204.7/1100000: 27% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando(3)
4:57.913 default S incinerate Fluffy_Pillow 320074.0/1100000: 29% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos, accelerando(4)
4:59.229 default S incinerate Fluffy_Pillow 273872.4/1100000: 25% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos
5:00.625 default J conflagrate Fluffy_Pillow 227731.8/1100000: 21% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos, accelerando

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4201 3876 0
Agility 7254 6929 0
Stamina 53145 53145 34622
Intellect 50653 48947 39293 (1278)
Spirit 1 1 0
Health 3188700 3188700 0
Mana 1100000 1100000 0
Soul Shard 5 5 0
Spell Power 50653 48947 0
Crit 15.51% 15.51% 4202
Haste 29.32% 28.32% 10620
Damage / Heal Versatility 4.93% 4.93% 2342
ManaReg per Second 14225 14115 0
Mastery 69.27% 69.27% 6034
Armor 1996 1996 1996
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 907.00
Local Head Eyes of Azj'Aqir
ilevel: 900, stats: { 253 Armor, +3255 Sta, +2170 Int, +1074 Haste, +578 Vers }
Local Neck Radiant String of Scorpid Eyes
ilevel: 900, stats: { +1831 Sta, +2011 Haste, +922 Crit }, enchant: mark_of_the_hidden_satyr
Local Shoulders Lessons of Space-Time
ilevel: 940, stats: { 269 Armor, +3544 Sta, +2362 Int, +822 Haste, +617 Mastery }
Local Chest Finery of Azj'Aqir
ilevel: 905, stats: { 317 Armor, +3410 Sta, +2273 Int, +1058 Mastery, +625 Crit }
Local Waist Man'ari Skullbuckled Cinch
ilevel: 900, stats: { 175 Armor, +2442 Sta, +1628 Int, +699 Haste, +540 Mastery }
Local Legs Leggings of Azj'Aqir
ilevel: 900, stats: { 272 Armor, +3255 Sta, +2170 Int, +932 Crit, +720 Haste }
Local Feet Outcast Wanderer's Footrags
ilevel: 910, stats: { 222 Armor, +2680 Sta, +1786 Int, +864 Crit, +422 Mastery }
Local Wrists Woven Lasher Tendril Bracers
ilevel: 900, stats: { 136 Armor, +1831 Sta, +1221 Int, +644 Haste, +285 Vers }
Local Hands Clutch of Azj'Aqir
ilevel: 900, stats: { 194 Armor, +2442 Sta, +1628 Int, +859 Crit, +380 Mastery }
Local Finger1 Ring of the Scoured Clan
ilevel: 900, stats: { +1831 Sta, +2095 Mastery, +838 Haste }, enchant: { +200 Haste }
Local Finger2 Ring of Braided Stems
ilevel: 905, stats: { +1918 Sta, +1814 Haste, +1209 Vers }, enchant: { +200 Haste }
Local Trinket1 Whispers in the Dark
ilevel: 905, stats: { +2162 Int }
Local Trinket2 Erratic Metronome
ilevel: 900, stats: { +2063 Int }
Local Back Astromancer's Greatcloak
ilevel: 905, stats: { 158 Armor, +1918 Sta, +1278 StrAgiInt, +676 Haste, +270 Vers }, enchant: { +200 Int }
Local Main Hand Scepter of Sargeras
ilevel: 929, weapon: { 7005 - 10509, 3.6 }, stats: { +2843 Int, +4265 Sta, +922 Haste, +922 Mastery, +15509 Int }, relics: { +61 ilevels, +59 ilevels, +61 ilevels }

Talents

Level
15 Backdraft (Destruction Warlock) Roaring Blaze (Destruction Warlock) Shadowburn (Destruction Warlock)
30 Reverse Entropy (Destruction Warlock) Eradication (Destruction Warlock) Empowered Life Tap
45 Demonic Circle Mortal Coil Shadowfury
60 Cataclysm (Destruction Warlock) Fire and Brimstone (Destruction Warlock) Soul Harvest
75 Demon Skin Burning Rush Dark Pact
90 Grimoire of Supremacy Grimoire of Service Grimoire of Sacrifice
100 Wreak Havoc (Destruction Warlock) Channel Demonfire (Destruction Warlock) Soul Conduit

Profile

warlock="Shoulders"
level=110
race=troll
role=spell
position=back
talents=2203021
artifact=38:142513:142516:142513:0:803:1:804:3:805:3:806:5:807:3:808:3:809:4:810:3:811:3:812:3:813:1:814:1:815:1:816:1:817:1:818:1:1355:1
spec=destruction

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,type=whispered_pact
actions.precombat+=/food,type=azshari_salad
actions.precombat+=/summon_pet,if=!talent.grimoire_of_supremacy.enabled&(!talent.grimoire_of_sacrifice.enabled|buff.demonic_power.down)
actions.precombat+=/summon_infernal,if=talent.grimoire_of_supremacy.enabled&artifact.lord_of_flames.rank>0
actions.precombat+=/summon_infernal,if=talent.grimoire_of_supremacy.enabled&active_enemies>1
actions.precombat+=/summon_doomguard,if=talent.grimoire_of_supremacy.enabled&active_enemies=1&artifact.lord_of_flames.rank=0
actions.precombat+=/augmentation,type=defiled
actions.precombat+=/snapshot_stats
actions.precombat+=/grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
actions.precombat+=/life_tap,if=talent.empowered_life_tap.enabled&!buff.empowered_life_tap.remains
actions.precombat+=/potion,name=prolonged_power
actions.precombat+=/chaos_bolt

# Executed every time the actor is available.
actions=havoc,target=2,if=active_enemies>1&(active_enemies<4|talent.wreak_havoc.enabled&active_enemies<6)&!debuff.havoc.remains
actions+=/dimensional_rift,if=charges=3
actions+=/immolate,if=remains<=tick_time
actions+=/immolate,cycle_targets=1,if=active_enemies>1&remains<=tick_time&(!talent.roaring_blaze.enabled|(!debuff.roaring_blaze.remains&action.conflagrate.charges<2))
actions+=/immolate,if=talent.roaring_blaze.enabled&remains<=duration&!debuff.roaring_blaze.remains&target.time_to_die>10&(action.conflagrate.charges=2+set_bonus.tier19_4pc|(action.conflagrate.charges>=1+set_bonus.tier19_4pc&action.conflagrate.recharge_time<cast_time+gcd)|target.time_to_die<24)
actions+=/berserking
actions+=/blood_fury
actions+=/arcane_torrent
actions+=/potion,name=deadly_grace,if=(buff.soul_harvest.remains|trinket.proc.any.react|target.time_to_die<=45)
actions+=/shadowburn,if=buff.conflagration_of_chaos.remains<=action.chaos_bolt.cast_time
actions+=/shadowburn,if=(charges=1&recharge_time<action.chaos_bolt.cast_time|charges=2)&soul_shard<5
actions+=/conflagrate,if=talent.roaring_blaze.enabled&(charges=2+set_bonus.tier19_4pc|(charges>=1+set_bonus.tier19_4pc&recharge_time<gcd)|target.time_to_die<24)
actions+=/conflagrate,if=talent.roaring_blaze.enabled&debuff.roaring_blaze.stack>0&dot.immolate.remains>dot.immolate.duration*0.3&(active_enemies=1|soul_shard<3)&soul_shard<5
actions+=/conflagrate,if=!talent.roaring_blaze.enabled&!buff.backdraft.remains&buff.conflagration_of_chaos.remains<=action.chaos_bolt.cast_time
actions+=/conflagrate,if=!talent.roaring_blaze.enabled&!buff.backdraft.remains&(charges=1&recharge_time<action.chaos_bolt.cast_time|charges=2)&soul_shard<5
actions+=/life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<=gcd
actions+=/dimensional_rift,if=equipped.144369&!buff.lessons_of_spacetime.remains&((!talent.grimoire_of_supremacy.enabled&!cooldown.summon_doomguard.remains)|(talent.grimoire_of_service.enabled&!cooldown.service_pet.remains)|(talent.soul_harvest.enabled&!cooldown.soul_harvest.remains))
actions+=/service_pet
actions+=/summon_infernal,if=artifact.lord_of_flames.rank>0&!buff.lord_of_flames.remains
actions+=/summon_doomguard,if=!talent.grimoire_of_supremacy.enabled&spell_targets.infernal_awakening<=2&(target.time_to_die>180|target.health.pct<=20|target.time_to_die<30)
actions+=/summon_infernal,if=!talent.grimoire_of_supremacy.enabled&spell_targets.infernal_awakening>2
actions+=/summon_doomguard,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal=1&artifact.lord_of_flames.rank>0&buff.lord_of_flames.remains&!pet.doomguard.active
actions+=/summon_doomguard,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal=1&equipped.132379&!cooldown.sindorei_spite_icd.remains
actions+=/summon_infernal,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal>1&equipped.132379&!cooldown.sindorei_spite_icd.remains
actions+=/soul_harvest
actions+=/channel_demonfire,if=dot.immolate.remains>cast_time
actions+=/havoc,if=active_enemies=1&talent.wreak_havoc.enabled&equipped.132375&!debuff.havoc.remains
actions+=/rain_of_fire,if=active_enemies>=3&cooldown.havoc.remains<=12&!talent.wreak_havoc.enabled
actions+=/rain_of_fire,if=active_enemies>=6&talent.wreak_havoc.enabled
actions+=/dimensional_rift,if=!equipped.144369|charges>1|((!talent.grimoire_of_service.enabled|recharge_time<cooldown.service_pet.remains)&(!talent.soul_harvest.enabled|recharge_time<cooldown.soul_harvest.remains)&(!talent.grimoire_of_supremacy.enabled|recharge_time<cooldown.summon_doomguard.remains))
actions+=/life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<duration*0.3
actions+=/cataclysm
actions+=/chaos_bolt,if=(cooldown.havoc.remains>12&cooldown.havoc.remains|active_enemies<3|talent.wreak_havoc.enabled&active_enemies<6)
actions+=/shadowburn
actions+=/conflagrate,if=!talent.roaring_blaze.enabled&!buff.backdraft.remains
actions+=/immolate,if=!talent.roaring_blaze.enabled&remains<=duration*0.3
actions+=/incinerate
actions+=/life_tap

head=eyes_of_azjaqir,id=138314,bonus_id=3445
neck=radiant_string_of_scorpid_eyes,id=140898,bonus_id=3445,enchant_id=5439
shoulders=lessons_of_spacetime,id=144369,ilevel=940
back=astromancers_greatcloak,id=140909,bonus_id=3518,enchant_id=5436
chest=finery_of_azjaqir,id=138320,bonus_id=3518
wrists=woven_lasher_tendril_bracers,id=140886,bonus_id=3445
hands=clutch_of_azjaqir,id=138311,bonus_id=3445
waist=manari_skullbuckled_cinch,id=140887,bonus_id=3445
legs=leggings_of_azjaqir,id=138317,bonus_id=3445
feet=outcast_wanderers_footrags,id=140914,bonus_id=3519
finger1=ring_of_the_scoured_clan,id=140897,bonus_id=3445,enchant=binding_of_haste
finger2=ring_of_braided_stems,id=140896,bonus_id=3518,enchant=binding_of_haste
trinket1=whispers_in_the_dark,id=140809,ilevel=905
trinket2=erratic_metronome,id=140792,ilevel=900
main_hand=scepter_of_sargeras,id=128941,ilevel=929,gem_id=140826/140837/140826,relic_id=3519/3518:3518/3519

# Gear Summary
# gear_ilvl=906.60
# gear_stamina=34622
# gear_intellect=39293
# gear_crit_rating=4202
# gear_haste_rating=10620
# gear_mastery_rating=6034
# gear_versatility_rating=2342
# gear_armor=1996
# set_bonus=tier19_2pc=1
# set_bonus=tier19_4pc=1
default_pet=imp

Spite : 1024402 dps, 602286 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
1024402.0 1024402.0 0.0 / 0.000% 0.0 / 0.0% 31.6
RPS Out RPS In Primary Resource Waiting APM Active Skill
26280.3 26280.3 Mana 0.00% 50.6 100.0% 100%
Talents
  • 15: Roaring Blaze (Destruction Warlock)
  • 30: Eradication (Destruction Warlock)
  • 60: Soul Harvest
  • 90: Grimoire of Service
  • 100: Wreak Havoc (Destruction Warlock)
  • Talent Calculator
Artifact

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Spite 1024402
Chaos Bolt 328154 32.1% 57.6 5.07sec 1712895 1127459 Direct 109.9 0 897534 897534 100.0%  

Stats details: chaos_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 57.58 109.88 0.00 0.00 1.5193 0.0000 98623309.02 98623309.02 0.00 1127458.55 1127458.55
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 109.88 100.00% 897534.06 570821 1542291 898329.18 841558 973330 98623309 98623309 0.00
 
 

Action details: chaos_bolt

Static Values
  • id:116858
  • school:chromatic
  • resource:soul_shard
  • range:40.0
  • travel_speed:16.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:2.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:116858
  • name:Chaos Bolt
  • school:chromatic
  • tooltip:
  • description:Unleashes a devastating blast of chaos, causing {$s1=1} Chaos damage. Chaos Bolt always critically strikes and your critical strike chance increases its damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:4.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Conflagrate 109573 10.7% 48.3 6.21sec 680502 654033 Direct 96.1 200499 456361 342162 55.4%  

Stats details: conflagrate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 48.35 96.15 0.00 0.00 1.0405 0.0000 32899186.17 32899186.17 0.00 654033.36 654033.36
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 42.91 44.63% 200498.79 129993 351183 200697.10 177076 226370 8604067 8604067 0.00
crit 53.24 55.37% 456360.54 260021 812571 456709.40 404069 515821 24295120 24295120 0.00
 
 

Action details: conflagrate

Static Values
  • id:17962
  • school:fire
  • resource:chi
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:9.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.roaring_blaze.enabled&(charges=2+set_bonus.tier19_4pc|(charges>=1+set_bonus.tier19_4pc&recharge_time<gcd)|target.time_to_die<24)
Spelldata
  • id:17962
  • name:Conflagrate
  • school:fire
  • tooltip:
  • description:Triggers an explosion on the target, dealing {$s1=1} Fire damage.{$?s196406=false}[ Reduces the cast time of Incinerate and Chaos Bolt by {$117828s1=30}% for {$117828d=10 seconds}.][] |cFFFFFFFFGenerates 1 Soul Shard.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.265510
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Deadly Grace 5264 0.5% 14.3 2.09sec 108815 0 Direct 14.3 94012 188234 108816 15.7%  

Stats details: deadly_grace

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.28 14.28 0.00 0.00 0.0000 0.0000 1554114.22 1554114.22 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 12.04 84.29% 94012.40 83413 100096 94019.25 87584 100096 1131754 1131754 0.00
crit 2.24 15.71% 188234.42 166827 200192 170734.40 0 200192 422361 422361 0.00
 
 

Action details: deadly_grace

Static Values
  • id:188091
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:25.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188091
  • name:Deadly Grace
  • school:arcane
  • tooltip:
  • description:Deal {$s1=63339 to 95008} Arcane damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:63338.72
  • base_dd_max:95008.08
 
Immolate 244117 23.8% 19.9 15.28sec 3676927 3490943 Direct 38.6 137650 275544 203427 47.7%  
Periodic 293.3 151099 302271 223155 47.7% 195.9%

Stats details: immolate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 19.94 38.60 293.29 293.29 1.0533 2.0115 73302820.80 73302820.80 0.00 119981.90 3490942.98
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 20.19 52.30% 137650.20 90202 243493 137689.54 114190 160701 2778908 2778908 0.00
crit 18.42 47.70% 275543.53 180380 486907 275618.28 235267 320476 5074288 5074288 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 153.5 52.34% 151099.17 30 484130 151414.65 128600 182422 23192859 23192859 0.00
crit 139.8 47.66% 302270.99 59 968255 302912.79 252120 362229 42256766 42256766 0.00
 
 

Action details: immolate

Static Values
  • id:348
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:66000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.32
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:remains<=tick_time
Spelldata
  • id:348
  • name:Immolate
  • school:fire
  • tooltip:
  • description:Burns the enemy, causing {$s1=1} Fire damage immediately and an additional $157736o1 Fire damage over {$157736d=18 seconds}. |cFFFFFFFFPeriodic damage has a {$193541s1=15}% chance to generate 1 Soul Shard. Chance doubled on critical strikes.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.332000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.721500
  • base_td:0.00
  • dot_duration:18.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Incinerate 136944 13.4% 80.1 3.58sec 514265 417226 Direct 153.4 232225 464468 268588 15.7%  

Stats details: incinerate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 80.10 153.37 0.00 0.00 1.2326 0.0000 41194018.77 41194018.77 0.00 417226.45 417226.45
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 129.36 84.34% 232224.81 145789 393901 232425.34 218218 251705 30040616 30040616 0.00
crit 24.01 15.66% 464468.16 291576 787796 464813.18 391555 552320 11153402 11153402 0.00
 
 

Action details: incinerate

Static Values
  • id:29722
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:66000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:29722
  • name:Incinerate
  • school:fire
  • tooltip:
  • description:Draws fire toward the enemy, dealing {$s2=0} Fire damage.{$?s29722=true}|!c3[][ Replaces Shadow Bolt.]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.331000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Mark of the Hidden Satyr 9159 0.9% 20.0 15.02sec 137750 0 Direct 20.0 119123 238436 137747 15.6%  

Stats details: mark_of_the_hidden_satyr

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 19.98 19.98 0.00 0.00 0.0000 0.0000 2751695.50 2751695.50 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 16.86 84.39% 119123.38 110344 160212 119185.90 110344 134317 2008093 2008093 0.00
crit 3.12 15.61% 238436.09 220687 320425 227894.56 0 320425 743602 743602 0.00
 
 

Action details: mark_of_the_hidden_satyr

Static Values
  • id:191259
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191259
  • name:Mark of the Hidden Satyr
  • school:fire
  • tooltip:
  • description:Deals fire damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:2.500000
  • spell_power_mod.direct:2.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
pet - imp 43589 / 43589
Firebolt 43589 4.3% 108.7 2.77sec 120508 98875 Direct 107.8 105051 210011 121443 15.6%  

Stats details: firebolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 108.68 107.84 0.00 0.00 1.2188 0.0000 13096355.13 13096355.13 0.00 98874.74 98874.74
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 91.00 84.38% 105050.96 65104 141791 105131.51 101962 108337 9559280 9559280 0.00
crit 16.84 15.62% 210011.05 130208 283581 210138.30 182730 246281 3537075 3537075 0.00
 
 

Action details: firebolt

Static Values
  • id:3110
  • school:fire
  • resource:energy
  • range:40.0
  • travel_speed:16.0000
  • trigger_gcd:0.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.75
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:3110
  • name:Firebolt
  • school:fire
  • tooltip:
  • description:Deals {$s1=1} Fire damage to a target.$?a231795[ Damage increased by {$231795s1=50}% if you have Immolated the target.][] |cFF777777(Right-Click to toggle)|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
pet - service_imp 130758 / 41720
Firebolt 130758 4.1% 49.1 5.54sec 254474 222389 Direct 48.8 221334 443039 255932 15.6%  

Stats details: firebolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 49.08 48.80 0.00 0.00 1.1443 0.0000 12488922.23 12488922.23 0.00 222389.01 222389.01
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 41.18 84.39% 221333.68 130208 283581 221764.11 205316 239534 9115196 9115196 0.00
crit 7.61 15.61% 443039.03 260416 567163 443557.35 0 567163 3373726 3373726 0.00
 
 

Action details: firebolt

Static Values
  • id:3110
  • school:fire
  • resource:energy
  • range:40.0
  • travel_speed:16.0000
  • trigger_gcd:0.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.75
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:3110
  • name:Firebolt
  • school:fire
  • tooltip:
  • description:Deals {$s1=1} Fire damage to a target.$?a231795[ Damage increased by {$231795s1=50}% if you have Immolated the target.][] |cFF777777(Right-Click to toggle)|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
pet - infernal 133407 / 11297
Immolation 103949 0.8% 1.0 0.00sec 2598841 0 Periodic 46.5 48303 96637 55883 15.7% 8.1%

Stats details: immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 23.25 46.51 0.0000 1.0477 2598841.05 2598841.05 0.00 106680.39 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 39.2 84.32% 48303.44 36280 50066 48307.47 46992 49828 1894159 1894159 0.00
crit 7.3 15.68% 96637.15 83444 100133 96624.06 0 100133 704682 704682 0.00
 
 

Action details: immolation

Static Values
  • id:19483
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!ticking
Spelldata
  • id:19483
  • name:Immolation
  • school:fire
  • tooltip:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
 

Action details: immolation_tick

Static Values
  • id:20153
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all enemies near the caster.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
melee 29458 0.2% 22.0 1.11sec 33451 30324 Direct 22.0 28922 57850 33452 15.7%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.02 22.02 0.00 0.00 1.1032 0.0000 736479.30 1082694.33 31.98 30324.01 30324.01
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 18.57 84.34% 28922.39 24950 29940 28922.68 28158 29940 537071 789545 31.98
crit 3.45 15.66% 57849.80 49900 59880 56295.97 0 59880 199408 293149 31.11
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
pet - doomguard 109391 / 9255
Doom Bolt 109391 0.9% 10.9 2.20sec 250513 116041 Direct 10.9 216432 432658 250546 15.8%  

Stats details: doom_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.92 10.92 0.00 0.00 2.1589 0.0000 2734844.36 2734844.36 0.00 116040.58 116040.58
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 9.19 84.23% 216432.42 182068 251254 216446.64 205477 251254 1989915 1989915 0.00
crit 1.72 15.77% 432657.65 364136 502508 367081.26 0 502508 744929 744929 0.00
 
 

Action details: doom_bolt

Static Values
  • id:85692
  • school:shadow
  • resource:energy
  • range:30.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:35.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:85692
  • name:Doom Bolt
  • school:shadow
  • tooltip:
  • description:Sends a shadowy bolt at the enemy, causing {$s1=1} Shadow damage. Deals {$s2=20}% additional damage to targets below 20% health.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
pet - lord_of_flames_infernal 133426 / 11298
Immolation 103981 0.8% 1.0 0.00sec 2599622 0 Periodic 46.5 48307 96600 55898 15.7% 8.1%

Stats details: immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 23.25 46.51 0.0000 1.0477 2599622.49 2599622.49 0.00 106712.47 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 39.2 84.28% 48306.89 36280 50066 48311.39 47032 49470 1893378 1893378 0.00
crit 7.3 15.72% 96600.06 72560 100133 96562.32 0 100133 706245 706245 0.00
 
 

Action details: immolation

Static Values
  • id:19483
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!ticking
Spelldata
  • id:19483
  • name:Immolation
  • school:fire
  • tooltip:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
 

Action details: immolation_tick

Static Values
  • id:20153
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all enemies near the caster.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
melee 29445 0.2% 22.0 1.11sec 33437 30311 Direct 22.0 28924 57832 33436 15.6%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.02 22.02 0.00 0.00 1.1032 0.0000 736151.92 1082213.05 31.98 30310.53 30310.53
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 18.58 84.39% 28923.99 24950 29940 28924.18 28021 29940 537398 790026 31.98
crit 3.44 15.61% 57832.45 49900 59880 56286.82 0 59880 198754 292187 31.12
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
pet - lord_of_flames_infernal 133471 / 11300
Immolation 104010 0.8% 1.0 0.00sec 2600348 0 Periodic 46.5 48306 96614 55914 15.8% 8.1%

Stats details: immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 23.25 46.51 0.0000 1.0477 2600347.65 2600347.65 0.00 106742.24 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 39.2 84.25% 48305.63 36280 50066 48309.67 46992 49649 1892653 1892653 0.00
crit 7.3 15.75% 96613.55 72560 100133 96589.74 0 100133 707695 707695 0.00
 
 

Action details: immolation

Static Values
  • id:19483
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!ticking
Spelldata
  • id:19483
  • name:Immolation
  • school:fire
  • tooltip:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
 

Action details: immolation_tick

Static Values
  • id:20153
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all enemies near the caster.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
melee 29461 0.2% 22.0 1.11sec 33455 30327 Direct 22.0 28920 57880 33454 15.7%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.02 22.02 0.00 0.00 1.1032 0.0000 736558.15 1082810.24 31.98 30327.26 30327.26
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 18.57 84.34% 28919.63 24950 29940 28919.45 28021 29940 536992 789429 31.98
crit 3.45 15.66% 57879.55 49900 59880 56534.86 0 59880 199566 293381 31.23
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
pet - lord_of_flames_infernal 133363 / 11293
Immolation 103899 0.8% 1.0 0.00sec 2597585 0 Periodic 46.5 48306 96607 55855 15.6% 8.1%

Stats details: immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 23.25 46.51 0.0000 1.0477 2597584.83 2597584.83 0.00 106628.83 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 39.2 84.37% 48306.28 36280 50066 48310.92 46992 49649 1895416 1895416 0.00
crit 7.3 15.63% 96606.56 72560 100133 96602.86 0 100133 702169 702169 0.00
 
 

Action details: immolation

Static Values
  • id:19483
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!ticking
Spelldata
  • id:19483
  • name:Immolation
  • school:fire
  • tooltip:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
 

Action details: immolation_tick

Static Values
  • id:20153
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all enemies near the caster.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
melee 29463 0.2% 22.0 1.11sec 33458 30330 Direct 22.0 28919 57884 33457 15.7%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.02 22.02 0.00 0.00 1.1032 0.0000 736614.54 1082893.15 31.98 30329.58 30329.58
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 18.57 84.33% 28919.22 24950 29940 28919.04 28021 29940 536936 789346 31.98
crit 3.45 15.67% 57883.89 49900 59880 56577.58 0 59880 199679 293547 31.26
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
pet - shadowy_tear 129278 / 21922
Shadow Bolt 129278 2.1% 4.4 59.44sec 1490561 0 Periodic 48.5 116939 233565 135232 15.7% 19.9%

Stats details: shadow_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.40 0.00 48.73 48.46 0.0000 1.2273 6553666.25 6553666.25 0.00 109576.59 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 40.9 84.32% 116938.95 58 154052 116631.48 0 154052 4778374 4778374 0.00
crit 7.6 15.68% 233564.91 335 308104 230755.01 0 308104 1775292 1775292 0.00
 
 

Action details: shadow_bolt

Static Values
  • id:196657
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:196657
  • name:Shadow Bolt
  • school:shadow
  • tooltip:
  • description:Sends a shadowy bolt at the enemy, causing {$s1=1} Shadow damage.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:14.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
pet - chaos_tear 144096 / 9975
Chaos Bolt 144096 1.0% 4.4 59.26sec 683693 343559 Direct 4.3 0 688424 688424 100.0%  

Stats details: chaos_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.38 4.35 0.00 0.00 1.9902 0.0000 2991708.52 2991708.52 0.00 343558.63 343558.63
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 4.35 100.00% 688424.10 613669 891012 689228.83 0 891012 2991709 2991709 0.00
 
 

Action details: chaos_bolt

Static Values
  • id:215279
  • school:chromatic
  • resource:none
  • range:100.0
  • travel_speed:16.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:5.500
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:215279
  • name:Chaos Bolt
  • school:chromatic
  • tooltip:
  • description:Unleashes a devastating blast of chaos, causing {$s1=1} Chaos damage. Chaos Bolt always critically strikes and your critical strike chance increases its damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:5.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
pet - chaos_portal 261945 / 19913
Chaos Barrage 261945 1.9% 4.4 58.65sec 1339032 0 Periodic 155.1 33149 66328 38349 15.7% 8.0%

Stats details: chaos_barrage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.44 0.00 155.86 155.10 0.0000 0.1548 5947757.78 5947757.78 0.00 246518.75 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 130.8 84.33% 33148.62 129 42365 33024.78 0 42365 4335410 4335410 0.00
crit 24.3 15.67% 66328.18 265 84731 66088.46 0 84731 1612348 1612348 0.00
 
 

Action details: chaos_barrage

Static Values
  • id:187394
  • school:magic
  • resource:none
  • range:100.0
  • travel_speed:24.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:187394
  • name:Chaos Barrage
  • school:magic
  • tooltip:
  • description:Deals {$s1=1} Chaos damage.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:5.50
  • base_tick_time:0.25
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Simple Action Stats Execute Interval
Spite
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Spite
  • harmful:false
  • if_expr:
 
Berserking 2.1 180.67sec

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.07 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=15}%.
  • description:Increases your haste by {$s1=15}% for {$d=10 seconds}.
 
Dimensional Rift 13.1 23.21sec

Stats details: dimensional_rift

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.15 0.00 0.00 0.00 1.0122 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: dimensional_rift

Static Values
  • id:196586
  • school:none
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:45.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:charges=3
Spelldata
  • id:196586
  • name:Dimensional Rift
  • school:chaos
  • tooltip:
  • description:Rips a hole in time and space, opening a portal that damages your target.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Spite
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Spite
  • harmful:false
  • if_expr:
 
Havoc 14.9 20.91sec

Stats details: havoc

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.90 0.00 0.00 0.00 1.0689 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: havoc

Static Values
  • id:80240
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:88000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies>1&(active_enemies<4|talent.wreak_havoc.enabled&active_enemies<6)&!debuff.havoc.remains
Spelldata
  • id:80240
  • name:Havoc
  • school:shadow
  • tooltip:Spells cast by the Warlock also hit this target.
  • description:Marks a target with Havoc for {$d=8 seconds}, causing your single target spells to also strike the Havoc victim. Limit 1.
 
Life Tap 7.6 30.45sec

Stats details: life_tap

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.62 0.00 0.00 0.00 1.0490 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: life_tap

Static Values
  • id:1454
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.empowered_life_tap.enabled&!buff.empowered_life_tap.remains
Spelldata
  • id:1454
  • name:Life Tap
  • school:shadow
  • tooltip:
  • description:Restores {$s1=30}% of your maximum mana, at the cost of {$s2=10}% of your maximum health.
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Grimoire: Imp (service_imp) 3.7 91.85sec

Stats details: service_imp

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.68 0.00 0.00 0.00 0.9738 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: service_imp

Static Values
  • id:111859
  • school:shadow
  • resource:soul_shard
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:90.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:111859
  • name:Grimoire: Imp
  • school:shadow
  • tooltip:
  • description:Summons an Imp who attacks the target for {$108501s1=25} sec. Imps cast ranged Firebolts and cleanse a hostile magic effect from their master.
 
Soul Harvest 2.9 120.90sec

Stats details: soul_harvest

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.90 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: soul_harvest

Static Values
  • id:196098
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:196098
  • name:Soul Harvest
  • school:shadow
  • tooltip:Damage increased by {$s1=20}%.
  • description:Increases your damage and your pets' damage by {$s1=20}%. Lasts {$d=15 seconds}, increased by {$s2=2} sec for each target afflicted by your {$?s137043=false}[Agony][]{$?s137044=false}[Doom][]{$?s137046=false}[Immolate][], up to a maximum of {$s3=35} sec.
 
Summon Doomguard 1.0 0.00sec

Stats details: summon_doomguard

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 1.0836 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_doomguard

Static Values
  • id:18540
  • school:shadow
  • resource:soul_shard
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.grimoire_of_supremacy.enabled&active_enemies=1&artifact.lord_of_flames.rank=0
Spelldata
  • id:18540
  • name:Summon Doomguard
  • school:shadow
  • tooltip:
  • description:Summons a Doomguard for {$60478d=25 seconds} to assault the target with its Doom Bolts.
 
Summon Imp 1.0 0.00sec

Stats details: summon_imp

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_imp

Static Values
  • id:688
  • school:shadow
  • resource:soul_shard
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!talent.grimoire_of_supremacy.enabled&(!talent.grimoire_of_sacrifice.enabled|buff.demonic_power.down)
Spelldata
  • id:688
  • name:Summon Imp
  • school:shadow
  • tooltip:
  • description:Summons an Imp under your command that casts ranged Firebolts.$?s74434[ |cFFFFFFFFSoulburn:|r |cFF8282FFInstant cast.|r][]
 
Summon Infernal 1.0 0.00sec

Stats details: summon_infernal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.7583 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_infernal

Static Values
  • id:1122
  • school:shadow
  • resource:soul_shard
  • range:30.0
  • travel_speed:1.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.grimoire_of_supremacy.enabled&artifact.lord_of_flames.rank>0
Spelldata
  • id:1122
  • name:Summon Infernal
  • school:shadow
  • tooltip:
  • description:Summons an Infernal from the Twisting Nether, impacting for {$22703s1=0} Fire damage and stunning all enemy targets in the area for {$22703d=2 seconds}. The Infernal will serve you for {$111685d=25 seconds}, dealing strong area-of-effect damage.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Accelerando 20.1 0.0 15.4sec 15.4sec 78.57% 78.57% 1.4(1.4) 19.3

Buff details

  • buff initial source:Spite
  • cooldown name:buff_accelerando
  • max_stacks:5
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:734.41

Stack Uptimes

  • accelerando_1:29.79%
  • accelerando_2:24.69%
  • accelerando_3:14.66%
  • accelerando_4:6.53%
  • accelerando_5:2.90%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225719
  • name:Accelerando
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc225125=Your damaging spells have a chance to grant you {$225719s1=528} Haste for {$225719d=12 seconds}, stacking up to 5 times. Stacking does not refresh duration.}
  • max_stacks:5
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Berserking 2.1 0.0 180.7sec 180.7sec 6.87% 8.44% 0.0(0.0) 2.0

Buff details

  • buff initial source:Spite
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:10.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • berserking_1:6.87%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=15}%.
  • description:Increases your haste by {$s1=15}% for {$d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.55% 15.47% 0.0(0.0) 1.0

Buff details

  • buff initial source:Spite
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:13.55%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Conflagration of Chaos 24.2 0.0 12.3sec 12.3sec 49.38% 47.04% 0.0(0.0) 1.0

Buff details

  • buff initial source:Spite
  • cooldown name:buff_conflagration_of_chaos
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:50.00%
  • default_value:-0.00

Stack Uptimes

  • conflagration_of_chaos_1:49.38%

Trigger Attempt Success

  • trigger_pct:50.13%

Spelldata details

  • id:196546
  • name:Conflagration of Chaos
  • tooltip:Your {$?s17877=false}[Shadowburn][Conflagrate] will always critically strike. Critical strike chance will increase the critical strike damage of {$?s17877=false}[Shadowburn][Conflagrate].
  • description:{$@spelldesc219195={$?s17877=false}[Shadowburn][Conflagrate] has a chance to guarantee your next {$?s17877=false}[Shadowburn][Conflagrate] critically strikes, and to increase its damage by your critical strike chance.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Devil's Due 3.5 0.0 69.4sec 69.4sec 8.71% 10.26% 0.0(0.0) 3.2

Buff details

  • buff initial source:Spite
  • cooldown name:buff_devils_due
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.18

Stack Uptimes

  • devils_due_1:8.71%

Trigger Attempt Success

  • trigger_pct:99.96%

Spelldata details

  • id:225776
  • name:Devil's Due
  • tooltip:Cast speed slowed by {$s1=7}%.
  • description:{$@spelldesc225142=Your damaging spells have a chance to grant Nefarious Pact, increasing your casting speed by {$225774s1=17}% for {$225774d=12 seconds}. When Nefarious Pact expires, your casting speed is decreased by {$225776s1=7}% for {$225776d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Embrace Chaos 26.2 32.4 11.7sec 5.1sec 59.33% 66.78% 32.4(32.4) 25.6

Buff details

  • buff initial source:Spite
  • cooldown name:buff_embrace_chaos
  • max_stacks:1
  • duration:4.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • embrace_chaos_1:59.33%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:212019
  • name:Embrace Chaos
  • tooltip:Chaos Bolt has {$s1=40}% reduced cast time.
  • description:{$@spelldesc212018=Casting Chaos Bolt reduces the cast time of your next Chaos Bolt by {$212019s1=40}% for {$212019d=4 seconds}.}
  • max_stacks:0
  • duration:4.00
  • cooldown:0.00
  • default_chance:0.00%
Lord of Flames 1.0 0.0 0.0sec 0.0sec 97.87% 97.87% 0.0(0.0) 0.0

Buff details

  • buff initial source:Spite
  • cooldown name:buff_lord_of_flames
  • max_stacks:1
  • duration:600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • lord_of_flames_1:97.87%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:226802
  • name:Lord of Flames
  • tooltip:Recently activated Lord of Flames.
  • description:{$@spelldesc224103=Once every {$s2=10} minutes, {$?s152107=false}[your Infernal's Meteor Strike][Summon Infernal] will summon {$s3=3} additional Infernals to serve you for {$226804d=25 seconds}.}
  • max_stacks:0
  • duration:600.00
  • cooldown:0.00
  • default_chance:0.00%
Nefarious Pact 3.5 0.0 69.8sec 69.0sec 13.55% 15.05% 0.0(0.0) 3.3

Buff details

  • buff initial source:Spite
  • cooldown name:buff_nefarious_pact
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.44

Stack Uptimes

  • nefarious_pact_1:13.55%

Trigger Attempt Success

  • trigger_pct:99.96%

Spelldata details

  • id:225774
  • name:Nefarious Pact
  • tooltip:Cast speed increased by {$s1=17}%.
  • description:{$@spelldesc225142=Your damaging spells have a chance to grant Nefarious Pact, increasing your casting speed by {$225774s1=17}% for {$225774d=12 seconds}. When Nefarious Pact expires, your casting speed is decreased by {$225776s1=7}% for {$225776d=8 seconds}.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of Deadly Grace 1.0 0.0 0.0sec 0.0sec 10.16% 10.16% 0.0(0.0) 1.0

Buff details

  • buff initial source:Spite
  • cooldown name:buff_potion_of_deadly_grace
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_deadly_grace_1:10.16%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188027
  • name:Potion of Deadly Grace
  • tooltip:Your attacks have a chance to unleash a bolt of energy at your target.
  • description:Grants your attacks a chance to unleash a bolt of energy at your target. Staying away from enemies for the entire duration of the effect will extend the effect by an additional 5 seconds.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
Potion of Prolonged Power 1.0 0.0 0.0sec 0.0sec 19.64% 19.64% 0.0(0.0) 1.0

Buff details

  • buff initial source:Spite
  • cooldown name:buff_potion_of_prolonged_power
  • max_stacks:1
  • duration:60.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:all
  • amount:2500.00

Stack Uptimes

  • potion_of_prolonged_power_1:19.64%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:229206
  • name:Potion of Prolonged Power
  • tooltip:All stats increased by {$s1=2500}.
  • description:Drink to increase all stats by {$s1=2500} for {$d=60 seconds}.
  • max_stacks:0
  • duration:60.00
  • cooldown:1.00
  • default_chance:0.00%
Sin'dorei Spite 2.0 0.0 230.9sec 230.9sec 16.93% 16.93% 0.0(0.0) 2.0

Buff details

  • buff initial source:Spite
  • cooldown name:buff_sindorei_spite
  • max_stacks:1
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15

Stack Uptimes

  • sindorei_spite_1:16.93%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:208871
  • name:Sin'dorei Spite
  • tooltip:You and your minions deal {$s1=15}% increased damage.
  • description:{$@spelldesc208868=For {$208871d=25 seconds} after casting Summon Doomguard or Summon Infernal, you and your minions deal {$208871s1=15}% increased damage.{$?s152107=false}[ This effect can be gained only once every {$s1=3} min.][]}
  • max_stacks:0
  • duration:25.00
  • cooldown:0.00
  • default_chance:0.00%
Soul Harvest 2.9 0.0 120.9sec 120.9sec 17.76% 17.76% 0.0(0.0) 2.7

Buff details

  • buff initial source:Spite
  • cooldown name:buff_soul_harvest
  • max_stacks:1
  • duration:15.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • soul_harvest_1:17.76%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:196098
  • name:Soul Harvest
  • tooltip:Damage increased by {$s1=20}%.
  • description:Increases your damage and your pets' damage by {$s1=20}%. Lasts {$d=15 seconds}, increased by {$s2=2} sec for each target afflicted by your {$?s137043=false}[Agony][]{$?s137044=false}[Doom][]{$?s137046=false}[Immolate][], up to a maximum of {$s3=35} sec.
  • max_stacks:0
  • duration:15.00
  • cooldown:120.00
  • default_chance:0.00%
Constant Buffs
Well Fed (azshari_salad)

Buff details

  • buff initial source:Spite
  • cooldown name:buff_azshari_salad
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:375.00

Stack Uptimes

  • azshari_salad_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225603
  • name:Well Fed
  • tooltip:Haste increased by $w1.
  • description:Increases haste by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Defiled Augmentation

Buff details

  • buff initial source:Spite
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Whispered Pact

Buff details

  • buff initial source:Spite
  • cooldown name:buff_flask_of_the_whispered_pact
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:1300.00

Stack Uptimes

  • flask_of_the_whispered_pact_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188031
  • name:Flask of the Whispered Pact
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%

Procs

Count Interval
shadowy_tear 4.4 59.2sec
chaos_tear 4.4 59.0sec
chaos_portal 4.4 58.8sec
dimension_ripper 4.0 54.1sec

Resources

Resource Usage Type Count Total Average RPE APR
Spite
chaos_bolt Soul Shard 58.6 117.2 2.0 2.0 841840.2
havoc Mana 14.9 1311017.9 88000.0 88000.2 0.0
immolate Mana 19.9 1315744.3 66000.0 65998.8 55.7
incinerate Mana 80.1 5286829.0 66000.0 66000.6 7.8
service_imp Soul Shard 3.7 3.7 1.0 1.0 0.0
summon_doomguard Soul Shard 1.0 1.0 1.0 1.0 0.0
summon_infernal Soul Shard 1.0 1.0 1.0 1.0 0.0
pet - imp
firebolt Energy 108.7 4347.1 40.0 40.0 3012.7
pet - service_imp
firebolt Energy 49.1 1963.2 40.0 40.0 6361.7
pet - doomguard
doom_bolt Energy 10.9 382.1 35.0 35.0 7157.5
Resource Gains Type Count Total Average Overflow
life_tap Mana 7.62 2514340.70 (35.67%) 330000.00 0.00 0.00%
immolate Soul Shard 64.93 64.41 (53.01%) 0.99 0.52 0.81%
conflagrate Soul Shard 48.35 48.30 (39.75%) 1.00 0.05 0.10%
mp5_regen Mana 475.94 4534953.24 (64.33%) 9528.47 89030.87 1.93%
soulsnatcher Soul Shard 8.79 8.79 (7.24%) 1.00 0.00 0.00%
pet - imp
energy_regen Energy 1900.99 4180.72 (100.00%) 2.20 21.60 0.51%
pet - service_imp
energy_regen Energy 442.19 1342.52 (100.00%) 3.04 61.75 4.40%
pet - doomguard
energy_regen Energy 15.83 341.10 (100.00%) 21.55 42.88 11.17%
Resource RPS-Gain RPS-Loss
Health 0.00 7986.27
Mana 23409.96 26280.25
Soul Shard 0.40 0.41
Combat End Resource Mean Min Max
Mana 237095.86 15170.36 491886.65
Soul Shard 1.69 0.00 5.00

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 1.4%

Statistics & Data Analysis

Fight Length
Sample Data Spite Fight Length
Count 9999
Mean 301.12
Minimum 221.26
Maximum 379.15
Spread ( max - min ) 157.89
Range [ ( max - min ) / 2 * 100% ] 26.22%
DPS
Sample Data Spite Damage Per Second
Count 9999
Mean 1024401.97
Minimum 905683.26
Maximum 1193131.39
Spread ( max - min ) 287448.13
Range [ ( max - min ) / 2 * 100% ] 14.03%
Priority Target DPS
Sample Data Spite Priority Target Damage Per Second
Count 9999
Mean 602285.75
Minimum 532673.87
Maximum 703403.58
Spread ( max - min ) 170729.71
Range [ ( max - min ) / 2 * 100% ] 14.17%
DPS(e)
Sample Data Spite Damage Per Second (Effective)
Count 9999
Mean 1024401.97
Minimum 905683.26
Maximum 1193131.39
Spread ( max - min ) 287448.13
Range [ ( max - min ) / 2 * 100% ] 14.03%
Damage
Sample Data Spite Damage
Count 9999
Mean 250325144.49
Minimum 179850606.98
Maximum 327132232.23
Spread ( max - min ) 147281625.26
Range [ ( max - min ) / 2 * 100% ] 29.42%
DTPS
Sample Data Spite Damage Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Spite Healing Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS(e)
Sample Data Spite Healing Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Spite Heal
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Spite Healing Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Spite Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
ETMI
Sample Data SpiteTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data Spite Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=whispered_pact
1 0.00 food,type=azshari_salad
2 0.00 summon_pet,if=!talent.grimoire_of_supremacy.enabled&(!talent.grimoire_of_sacrifice.enabled|buff.demonic_power.down)
3 0.00 summon_infernal,if=talent.grimoire_of_supremacy.enabled&artifact.lord_of_flames.rank>0
4 0.00 summon_infernal,if=talent.grimoire_of_supremacy.enabled&active_enemies>1
5 0.00 summon_doomguard,if=talent.grimoire_of_supremacy.enabled&active_enemies=1&artifact.lord_of_flames.rank=0
6 0.00 augmentation,type=defiled
7 0.00 snapshot_stats
8 0.00 grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
9 0.00 life_tap,if=talent.empowered_life_tap.enabled&!buff.empowered_life_tap.remains
A 0.00 potion,name=prolonged_power
B 0.00 chaos_bolt
Default action list Executed every time the actor is available.
# count action,conditions
C 14.90 havoc,target=2,if=active_enemies>1&(active_enemies<4|talent.wreak_havoc.enabled&active_enemies<6)&!debuff.havoc.remains
D 1.00 dimensional_rift,if=charges=3
E 10.31 immolate,if=remains<=tick_time
F 0.63 immolate,cycle_targets=1,if=active_enemies>1&remains<=tick_time&(!talent.roaring_blaze.enabled|(!debuff.roaring_blaze.remains&action.conflagrate.charges<2))
G 9.05 immolate,if=talent.roaring_blaze.enabled&remains<=duration&!debuff.roaring_blaze.remains&target.time_to_die>10&(action.conflagrate.charges=2+set_bonus.tier19_4pc|(action.conflagrate.charges>=1+set_bonus.tier19_4pc&action.conflagrate.recharge_time<cast_time+gcd)|target.time_to_die<24)
H 2.07 berserking
0.00 blood_fury
0.00 arcane_torrent
I 1.00 potion,name=deadly_grace,if=(buff.soul_harvest.remains|trinket.proc.any.react|target.time_to_die<=45)
0.00 shadowburn,if=buff.conflagration_of_chaos.remains<=action.chaos_bolt.cast_time
0.00 shadowburn,if=(charges=1&recharge_time<action.chaos_bolt.cast_time|charges=2)&soul_shard<5
J 13.83 conflagrate,if=talent.roaring_blaze.enabled&(charges=2+set_bonus.tier19_4pc|(charges>=1+set_bonus.tier19_4pc&recharge_time<gcd)|target.time_to_die<24)
K 34.52 conflagrate,if=talent.roaring_blaze.enabled&debuff.roaring_blaze.stack>0&dot.immolate.remains>dot.immolate.duration*0.3&(active_enemies=1|soul_shard<3)&soul_shard<5
0.00 conflagrate,if=!talent.roaring_blaze.enabled&!buff.backdraft.remains&buff.conflagration_of_chaos.remains<=action.chaos_bolt.cast_time
0.00 conflagrate,if=!talent.roaring_blaze.enabled&!buff.backdraft.remains&(charges=1&recharge_time<action.chaos_bolt.cast_time|charges=2)&soul_shard<5
0.00 life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<=gcd
0.00 dimensional_rift,if=equipped.144369&!buff.lessons_of_spacetime.remains&((!talent.grimoire_of_supremacy.enabled&!cooldown.summon_doomguard.remains)|(talent.grimoire_of_service.enabled&!cooldown.service_pet.remains)|(talent.soul_harvest.enabled&!cooldown.soul_harvest.remains))
L 3.68 service_pet
M 1.00 summon_infernal,if=artifact.lord_of_flames.rank>0&!buff.lord_of_flames.remains
N 1.00 summon_doomguard,if=!talent.grimoire_of_supremacy.enabled&spell_targets.infernal_awakening<=2&(target.time_to_die>180|target.health.pct<=20|target.time_to_die<30)
0.00 summon_infernal,if=!talent.grimoire_of_supremacy.enabled&spell_targets.infernal_awakening>2
0.00 summon_doomguard,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal=1&artifact.lord_of_flames.rank>0&buff.lord_of_flames.remains&!pet.doomguard.active
0.00 summon_doomguard,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal=1&equipped.132379&!cooldown.sindorei_spite_icd.remains
0.00 summon_infernal,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal>1&equipped.132379&!cooldown.sindorei_spite_icd.remains
O 2.90 soul_harvest
0.00 channel_demonfire,if=dot.immolate.remains>cast_time
0.00 havoc,if=active_enemies=1&talent.wreak_havoc.enabled&equipped.132375&!debuff.havoc.remains
0.00 rain_of_fire,if=active_enemies>=3&cooldown.havoc.remains<=12&!talent.wreak_havoc.enabled
0.00 rain_of_fire,if=active_enemies>=6&talent.wreak_havoc.enabled
P 12.15 dimensional_rift,if=!equipped.144369|charges>1|((!talent.grimoire_of_service.enabled|recharge_time<cooldown.service_pet.remains)&(!talent.soul_harvest.enabled|recharge_time<cooldown.soul_harvest.remains)&(!talent.grimoire_of_supremacy.enabled|recharge_time<cooldown.summon_doomguard.remains))
0.00 life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<duration*0.3
0.00 cataclysm
Q 57.89 chaos_bolt,if=(cooldown.havoc.remains>12&cooldown.havoc.remains|active_enemies<3|talent.wreak_havoc.enabled&active_enemies<6)
0.00 shadowburn
0.00 conflagrate,if=!talent.roaring_blaze.enabled&!buff.backdraft.remains
0.00 immolate,if=!talent.roaring_blaze.enabled&remains<=duration*0.3
R 80.44 incinerate
S 7.62 life_tap

Sample Sequence

0126ABCDEGHJKLKMOPPQQKQKRQRQKQRCQRRRRQERRQRRRRGJPQKKQKCQKQPRRQRRERPRQCGJKQKQRKQRRKQQCRPRPSEQRQPRRRGJKLKCPQKQRRRSQKRRRRQEQCQROIRRSGJKQKPQQKQQRRCQKRRQEQRRRRRSQCGJKQKQKQQRRKPHRRCQRELRQRRRSGJKKQQRQRCKQKQQRQRERRQPCQGJKNKQQKRRRRKOQCSRERRRRRSRRGJKQCKKPQQRJLQRRJERPCQJQRRR

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask Spite 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 1 food Spite 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 2 summon_imp Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 6 augmentation Spite 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat A potion Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard potion_of_prolonged_power
0:00.000 precombat B chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard embrace_chaos, accelerando, potion_of_prolonged_power
0:00.000 default C havoc enemy2 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard embrace_chaos, accelerando, potion_of_prolonged_power
0:01.144 default D dimensional_rift Fluffy_Pillow 1033503.8/1100000: 94% mana | 1.0/5: 20% soul_shard bloodlust, embrace_chaos, accelerando, potion_of_prolonged_power
0:02.025 default E immolate Fluffy_Pillow 1050064.1/1100000: 95% mana | 1.0/5: 20% soul_shard bloodlust, embrace_chaos, accelerando, potion_of_prolonged_power
0:02.906 default G immolate Fluffy_Pillow 1000625.4/1100000: 91% mana | 1.0/5: 20% soul_shard bloodlust, embrace_chaos, accelerando(2), potion_of_prolonged_power
0:03.774 default H berserking Fluffy_Pillow 951185.6/1100000: 86% mana | 1.0/5: 20% soul_shard bloodlust, embrace_chaos, accelerando(3), potion_of_prolonged_power
0:03.774 default J conflagrate Fluffy_Pillow 951185.6/1100000: 86% mana | 1.0/5: 20% soul_shard bloodlust, berserking, embrace_chaos, accelerando(3), potion_of_prolonged_power
0:04.529 default K conflagrate Fluffy_Pillow 967992.6/1100000: 88% mana | 2.0/5: 40% soul_shard bloodlust, berserking, conflagration_of_chaos, accelerando(3), potion_of_prolonged_power
0:05.282 default L service_imp Fluffy_Pillow 984997.7/1100000: 90% mana | 3.0/5: 60% soul_shard bloodlust, berserking, accelerando(4), potion_of_prolonged_power
0:06.037 default K conflagrate Fluffy_Pillow 1002048.0/1100000: 91% mana | 2.0/5: 40% soul_shard bloodlust, berserking, accelerando(4), potion_of_prolonged_power
0:06.791 default M summon_infernal Fluffy_Pillow 1019318.4/1100000: 93% mana | 4.0/5: 80% soul_shard bloodlust, berserking, accelerando(5), potion_of_prolonged_power
0:07.547 default O soul_harvest Fluffy_Pillow 1036634.6/1100000: 94% mana | 3.0/5: 60% soul_shard bloodlust, berserking, lord_of_flames, sindorei_spite, accelerando(5), potion_of_prolonged_power
0:07.547 default P dimensional_rift Fluffy_Pillow 1036634.6/1100000: 94% mana | 3.0/5: 60% soul_shard bloodlust, berserking, soul_harvest, lord_of_flames, sindorei_spite, accelerando(5), potion_of_prolonged_power
0:08.301 default P dimensional_rift Fluffy_Pillow 1053905.0/1100000: 96% mana | 3.0/5: 60% soul_shard bloodlust, berserking, soul_harvest, lord_of_flames, sindorei_spite, accelerando(5), potion_of_prolonged_power
0:09.055 default Q chaos_bolt Fluffy_Pillow 1071175.4/1100000: 97% mana | 5.0/5: 100% soul_shard bloodlust, berserking, soul_harvest, lord_of_flames, sindorei_spite, accelerando(5), potion_of_prolonged_power
0:10.500 default Q chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard bloodlust, berserking, soul_harvest, lord_of_flames, embrace_chaos, sindorei_spite, accelerando(5), potion_of_prolonged_power
0:11.368 default K conflagrate Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard bloodlust, berserking, soul_harvest, lord_of_flames, embrace_chaos, sindorei_spite, accelerando(5), potion_of_prolonged_power
0:12.122 default Q chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 2.0/5: 40% soul_shard bloodlust, berserking, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, sindorei_spite, potion_of_prolonged_power
0:13.055 default K conflagrate Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/5: 0% soul_shard bloodlust, berserking, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, sindorei_spite, accelerando, potion_of_prolonged_power
0:13.822 default R incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard bloodlust, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, sindorei_spite, accelerando, potion_of_prolonged_power
0:14.880 default Q chaos_bolt Fluffy_Pillow 1034095.4/1100000: 94% mana | 2.0/5: 40% soul_shard bloodlust, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, sindorei_spite, accelerando(2), potion_of_prolonged_power
0:15.922 default R incinerate Fluffy_Pillow 1053974.0/1100000: 96% mana | 0.0/5: 0% soul_shard bloodlust, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, sindorei_spite, accelerando(2), potion_of_prolonged_power
0:16.963 default Q chaos_bolt Fluffy_Pillow 1007833.5/1100000: 92% mana | 2.0/5: 40% soul_shard bloodlust, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, sindorei_spite, accelerando(2), potion_of_prolonged_power
0:18.005 default K conflagrate Fluffy_Pillow 1027712.1/1100000: 93% mana | 1.0/5: 20% soul_shard bloodlust, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, sindorei_spite, accelerando(2), potion_of_prolonged_power
0:18.874 default Q chaos_bolt Fluffy_Pillow 1044290.3/1100000: 95% mana | 3.0/5: 60% soul_shard bloodlust, soul_harvest, lord_of_flames, embrace_chaos, sindorei_spite, accelerando(2), potion_of_prolonged_power
0:19.917 default R incinerate Fluffy_Pillow 1064188.0/1100000: 97% mana | 1.0/5: 20% soul_shard bloodlust, soul_harvest, lord_of_flames, embrace_chaos, sindorei_spite, accelerando(2), potion_of_prolonged_power
0:20.959 default C havoc enemy2 1018066.6/1100000: 93% mana | 2.0/5: 40% soul_shard bloodlust, soul_harvest, lord_of_flames, embrace_chaos, sindorei_spite, nefarious_pact, accelerando(2), potion_of_prolonged_power
0:21.713 default Q chaos_bolt Fluffy_Pillow 944450.9/1100000: 86% mana | 2.0/5: 40% soul_shard bloodlust, soul_harvest, lord_of_flames, embrace_chaos, sindorei_spite, nefarious_pact, accelerando(2), potion_of_prolonged_power
0:22.466 default R incinerate Fluffy_Pillow 959013.7/1100000: 87% mana | 0.0/5: 0% soul_shard bloodlust, soul_harvest, lord_of_flames, embrace_chaos, sindorei_spite, nefarious_pact, accelerando(3), potion_of_prolonged_power
0:23.222 default R incinerate Fluffy_Pillow 907647.8/1100000: 83% mana | 1.0/5: 20% soul_shard bloodlust, soul_harvest, lord_of_flames, embrace_chaos, sindorei_spite, nefarious_pact, accelerando(3), potion_of_prolonged_power
0:23.978 default R incinerate Fluffy_Pillow 856281.9/1100000: 78% mana | 1.0/5: 20% soul_shard bloodlust, soul_harvest, lord_of_flames, embrace_chaos, sindorei_spite, nefarious_pact, accelerando(3), potion_of_prolonged_power
0:24.731 default R incinerate Fluffy_Pillow 804870.5/1100000: 73% mana | 1.0/5: 20% soul_shard bloodlust, soul_harvest, lord_of_flames, embrace_chaos, sindorei_spite, nefarious_pact, accelerando(4), potion_of_prolonged_power
0:25.485 default Q chaos_bolt Fluffy_Pillow 753237.1/1100000: 68% mana | 2.0/5: 40% soul_shard bloodlust, soul_harvest, lord_of_flames, embrace_chaos, sindorei_spite, nefarious_pact, accelerando, potion_of_prolonged_power
0:26.239 default E immolate Fluffy_Pillow 767410.1/1100000: 70% mana | 0.0/5: 0% soul_shard bloodlust, soul_harvest, lord_of_flames, embrace_chaos, sindorei_spite, nefarious_pact, accelerando, potion_of_prolonged_power
0:26.994 default R incinerate Fluffy_Pillow 715601.9/1100000: 65% mana | 1.0/5: 20% soul_shard bloodlust, lord_of_flames, embrace_chaos, sindorei_spite, nefarious_pact, accelerando, potion_of_prolonged_power
0:27.747 default R incinerate Fluffy_Pillow 663762.8/1100000: 60% mana | 1.0/5: 20% soul_shard bloodlust, lord_of_flames, embrace_chaos, sindorei_spite, nefarious_pact, accelerando(2), potion_of_prolonged_power
0:28.501 default Q chaos_bolt Fluffy_Pillow 612147.1/1100000: 56% mana | 2.0/5: 40% soul_shard bloodlust, lord_of_flames, embrace_chaos, sindorei_spite, nefarious_pact, accelerando(2), potion_of_prolonged_power
0:29.255 default R incinerate Fluffy_Pillow 626541.5/1100000: 57% mana | 0.0/5: 0% soul_shard bloodlust, lord_of_flames, embrace_chaos, sindorei_spite, nefarious_pact, accelerando(3), potion_of_prolonged_power
0:30.008 default R incinerate Fluffy_Pillow 575130.1/1100000: 52% mana | 1.0/5: 20% soul_shard bloodlust, lord_of_flames, embrace_chaos, sindorei_spite, nefarious_pact, accelerando(4), potion_of_prolonged_power
0:30.762 default R incinerate Fluffy_Pillow 523936.8/1100000: 48% mana | 1.0/5: 20% soul_shard bloodlust, lord_of_flames, embrace_chaos, sindorei_spite, nefarious_pact, accelerando(4), potion_of_prolonged_power
0:31.518 default R incinerate Fluffy_Pillow 472799.0/1100000: 43% mana | 1.0/5: 20% soul_shard bloodlust, lord_of_flames, embrace_chaos, sindorei_spite, nefarious_pact, accelerando(5), potion_of_prolonged_power
0:32.272 default G immolate Fluffy_Pillow 421816.8/1100000: 38% mana | 1.0/5: 20% soul_shard bloodlust, lord_of_flames, embrace_chaos, nefarious_pact, accelerando(5), potion_of_prolonged_power
0:33.027 default J conflagrate Fluffy_Pillow 370854.4/1100000: 34% mana | 1.0/5: 20% soul_shard bloodlust, lord_of_flames, embrace_chaos, devils_due, accelerando(5), potion_of_prolonged_power
0:34.009 default P dimensional_rift Fluffy_Pillow 390413.3/1100000: 35% mana | 3.0/5: 60% soul_shard bloodlust, lord_of_flames, conflagration_of_chaos, devils_due, accelerando(5), potion_of_prolonged_power
0:34.989 default Q chaos_bolt Fluffy_Pillow 409932.4/1100000: 37% mana | 3.0/5: 60% soul_shard bloodlust, lord_of_flames, conflagration_of_chaos, devils_due, accelerando(5), potion_of_prolonged_power
0:36.945 default K conflagrate Fluffy_Pillow 448890.9/1100000: 41% mana | 1.0/5: 20% soul_shard bloodlust, lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due, accelerando(5), potion_of_prolonged_power
0:37.925 default K conflagrate Fluffy_Pillow 467562.8/1100000: 43% mana | 2.0/5: 40% soul_shard bloodlust, lord_of_flames, embrace_chaos, devils_due, potion_of_prolonged_power
0:38.979 default Q chaos_bolt Fluffy_Pillow 487079.9/1100000: 44% mana | 3.0/5: 60% soul_shard bloodlust, lord_of_flames, embrace_chaos, devils_due, potion_of_prolonged_power
0:40.243 default K conflagrate Fluffy_Pillow 510485.6/1100000: 46% mana | 1.0/5: 20% soul_shard bloodlust, lord_of_flames, embrace_chaos, devils_due, potion_of_prolonged_power
0:41.296 default C havoc enemy2 525484.5/1100000: 48% mana | 3.0/5: 60% soul_shard lord_of_flames, embrace_chaos, potion_of_prolonged_power
0:42.458 default Q chaos_bolt Fluffy_Pillow 454036.0/1100000: 41% mana | 3.0/5: 60% soul_shard lord_of_flames, embrace_chaos, potion_of_prolonged_power
0:43.853 default K conflagrate Fluffy_Pillow 473906.3/1100000: 43% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, potion_of_prolonged_power
0:45.263 default Q chaos_bolt Fluffy_Pillow 493990.3/1100000: 45% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, potion_of_prolonged_power
0:46.657 default P dimensional_rift Fluffy_Pillow 513847.5/1100000: 47% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos, accelerando, potion_of_prolonged_power
0:47.800 default R incinerate Fluffy_Pillow 530374.5/1100000: 48% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos, accelerando, potion_of_prolonged_power
0:49.173 default R incinerate Fluffy_Pillow 484227.9/1100000: 44% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando(2), potion_of_prolonged_power
0:50.526 default Q chaos_bolt Fluffy_Pillow 438083.0/1100000: 40% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando(2), potion_of_prolonged_power
0:51.877 default R incinerate Fluffy_Pillow 457909.4/1100000: 42% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos, accelerando(3), potion_of_prolonged_power
0:53.209 default R incinerate Fluffy_Pillow 411743.2/1100000: 37% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos, accelerando(3), potion_of_prolonged_power
0:54.541 default E immolate Fluffy_Pillow 365577.6/1100000: 33% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos, accelerando(4), potion_of_prolonged_power
0:55.636 default R incinerate Fluffy_Pillow 316118.4/1100000: 29% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos, accelerando(4), potion_of_prolonged_power
0:56.950 default P dimensional_rift Fluffy_Pillow 269967.4/1100000: 25% mana | 1.0/5: 20% soul_shard lord_of_flames, accelerando(4), potion_of_prolonged_power
0:58.048 default R incinerate Fluffy_Pillow 286553.5/1100000: 26% mana | 1.0/5: 20% soul_shard lord_of_flames, accelerando(4)
0:59.364 default Q chaos_bolt Fluffy_Pillow 239820.4/1100000: 22% mana | 2.0/5: 40% soul_shard lord_of_flames, accelerando
1:01.652 default C havoc enemy2 272903.3/1100000: 25% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos, accelerando
1:02.797 default G immolate Fluffy_Pillow 201459.1/1100000: 18% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos, accelerando
1:03.941 default J conflagrate Fluffy_Pillow 152000.6/1100000: 14% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos, accelerando
1:05.086 default K conflagrate Fluffy_Pillow 168556.4/1100000: 15% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
1:06.233 default Q chaos_bolt Fluffy_Pillow 185141.2/1100000: 17% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, accelerando
1:08.521 default K conflagrate Fluffy_Pillow 218453.0/1100000: 20% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
1:09.648 default Q chaos_bolt Fluffy_Pillow 234991.6/1100000: 21% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando(2)
1:11.001 default R incinerate Fluffy_Pillow 254847.8/1100000: 23% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando(3)
1:12.336 default K conflagrate Fluffy_Pillow 208094.2/1100000: 19% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos
1:13.500 default Q chaos_bolt Fluffy_Pillow 224674.2/1100000: 20% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
1:14.894 default R incinerate Fluffy_Pillow 244664.4/1100000: 22% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
1:16.268 default R incinerate Fluffy_Pillow 198531.5/1100000: 18% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
1:17.640 default K conflagrate Fluffy_Pillow 152369.6/1100000: 14% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
1:19.030 default Q chaos_bolt Fluffy_Pillow 172468.0/1100000: 16% mana | 4.0/5: 80% soul_shard lord_of_flames, accelerando
1:21.317 default Q chaos_bolt Fluffy_Pillow 205572.2/1100000: 19% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, nefarious_pact, accelerando(2)
1:22.255 default C havoc enemy2 219337.2/1100000: 20% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos, nefarious_pact, accelerando(2)
1:23.039 default R incinerate Fluffy_Pillow 142842.3/1100000: 13% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos, nefarious_pact, accelerando(2)
1:23.977 default P dimensional_rift Fluffy_Pillow 90607.4/1100000: 8% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos, nefarious_pact, accelerando(2)
1:24.761 default R incinerate Fluffy_Pillow 102112.5/1100000: 9% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos, nefarious_pact, accelerando(2)
1:25.697 default P dimensional_rift Fluffy_Pillow 49848.2/1100000: 5% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos, nefarious_pact, accelerando(2)
1:26.481 default S life_tap Fluffy_Pillow 61262.8/1100000: 6% mana | 0.0/5: 0% soul_shard lord_of_flames, nefarious_pact
1:27.287 default E immolate Fluffy_Pillow 402743.4/1100000: 37% mana | 1.0/5: 20% soul_shard lord_of_flames, nefarious_pact
1:28.093 default Q chaos_bolt Fluffy_Pillow 348387.5/1100000: 32% mana | 2.0/5: 40% soul_shard lord_of_flames, nefarious_pact, accelerando(2)
1:29.655 default R incinerate Fluffy_Pillow 371309.6/1100000: 34% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, nefarious_pact, accelerando(2)
1:30.595 default Q chaos_bolt Fluffy_Pillow 319105.3/1100000: 29% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, nefarious_pact, accelerando(3)
1:31.520 default P dimensional_rift Fluffy_Pillow 332878.7/1100000: 30% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, nefarious_pact, accelerando(3)
1:32.293 default R incinerate Fluffy_Pillow 344388.9/1100000: 31% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, nefarious_pact, accelerando(3)
1:33.218 default R incinerate Fluffy_Pillow 292162.3/1100000: 27% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, devils_due, accelerando(3)
1:34.790 default R incinerate Fluffy_Pillow 249569.7/1100000: 23% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, devils_due, accelerando(3)
1:36.359 default G immolate Fluffy_Pillow 206932.4/1100000: 19% mana | 1.0/5: 20% soul_shard lord_of_flames, devils_due, accelerando(3)
1:37.668 default J conflagrate Fluffy_Pillow 160423.6/1100000: 15% mana | 1.0/5: 20% soul_shard lord_of_flames, devils_due, accelerando(3)
1:38.979 default K conflagrate Fluffy_Pillow 179944.6/1100000: 16% mana | 2.0/5: 40% soul_shard lord_of_flames, devils_due, accelerando(3)
1:40.290 default L service_imp Fluffy_Pillow 199016.3/1100000: 18% mana | 3.0/5: 60% soul_shard lord_of_flames, devils_due, accelerando
1:41.640 default K conflagrate Fluffy_Pillow 218536.3/1100000: 20% mana | 2.0/5: 40% soul_shard lord_of_flames, accelerando
1:42.784 default C havoc enemy2 235077.7/1100000: 21% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, nefarious_pact, accelerando
1:43.579 default P dimensional_rift Fluffy_Pillow 158744.2/1100000: 14% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, nefarious_pact, accelerando(2)
1:44.361 default Q chaos_bolt Fluffy_Pillow 170388.4/1100000: 15% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, nefarious_pact, accelerando(3)
1:45.899 default K conflagrate Fluffy_Pillow 193289.5/1100000: 18% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(3)
1:46.671 default Q chaos_bolt Fluffy_Pillow 204784.7/1100000: 19% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(3)
1:47.599 default R incinerate Fluffy_Pillow 218602.8/1100000: 20% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(3)
1:48.525 default R incinerate Fluffy_Pillow 166391.1/1100000: 15% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(3)
1:49.449 default R incinerate Fluffy_Pillow 114149.6/1100000: 10% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(3)
1:50.373 default S life_tap Fluffy_Pillow 61908.2/1100000: 6% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(3)
1:51.145 default Q chaos_bolt Fluffy_Pillow 403403.4/1100000: 37% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(3)
1:52.070 default K conflagrate Fluffy_Pillow 416822.3/1100000: 38% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando
1:52.865 default R incinerate Fluffy_Pillow 428317.4/1100000: 39% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, nefarious_pact, accelerando
1:53.819 default R incinerate Fluffy_Pillow 376111.5/1100000: 34% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, nefarious_pact, accelerando
1:54.772 default R incinerate Fluffy_Pillow 323891.2/1100000: 29% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, devils_due, accelerando
1:56.392 default R incinerate Fluffy_Pillow 281315.3/1100000: 26% mana | 1.0/5: 20% soul_shard lord_of_flames, devils_due, accelerando
1:58.009 default Q chaos_bolt Fluffy_Pillow 238846.6/1100000: 22% mana | 2.0/5: 40% soul_shard lord_of_flames, devils_due, accelerando(2)
2:00.664 default E immolate Fluffy_Pillow 277808.4/1100000: 25% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, devils_due, accelerando(2)
2:01.992 default Q chaos_bolt Fluffy_Pillow 231296.7/1100000: 21% mana | 4.0/5: 80% soul_shard lord_of_flames, embrace_chaos, devils_due, accelerando(2)
2:03.586 default C havoc enemy2 254689.5/1100000: 23% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando(3)
2:04.698 default Q chaos_bolt Fluffy_Pillow 182852.1/1100000: 17% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando
2:06.073 default R incinerate Fluffy_Pillow 202733.6/1100000: 18% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos, accelerando
2:07.447 default O soul_harvest Fluffy_Pillow 156600.7/1100000: 14% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos, accelerando
2:07.547 default I potion Fluffy_Pillow 158046.6/1100000: 14% mana | 0.0/5: 0% soul_shard soul_harvest, lord_of_flames, embrace_chaos, accelerando
2:07.547 default R incinerate Fluffy_Pillow 158046.6/1100000: 14% mana | 0.0/5: 0% soul_shard soul_harvest, lord_of_flames, embrace_chaos, accelerando, potion_of_deadly_grace
2:08.921 default R incinerate Fluffy_Pillow 111914.7/1100000: 10% mana | 0.0/5: 0% soul_shard soul_harvest, lord_of_flames, embrace_chaos, accelerando(2), potion_of_deadly_grace
2:10.274 default S life_tap Fluffy_Pillow 65769.9/1100000: 6% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, accelerando(2), potion_of_deadly_grace
2:11.403 default G immolate Fluffy_Pillow 412337.8/1100000: 37% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, accelerando(2), potion_of_deadly_grace
2:12.533 default J conflagrate Fluffy_Pillow 362920.4/1100000: 33% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, accelerando(2), potion_of_deadly_grace
2:13.663 default K conflagrate Fluffy_Pillow 379503.0/1100000: 35% mana | 2.0/5: 40% soul_shard soul_harvest, lord_of_flames, accelerando(2), potion_of_deadly_grace
2:14.792 default Q chaos_bolt Fluffy_Pillow 396071.0/1100000: 36% mana | 3.0/5: 60% soul_shard soul_harvest, lord_of_flames, nefarious_pact, accelerando(2), potion_of_deadly_grace
2:16.356 default K conflagrate Fluffy_Pillow 419252.2/1100000: 38% mana | 2.0/5: 40% soul_shard soul_harvest, lord_of_flames, embrace_chaos, nefarious_pact, accelerando(3), potion_of_deadly_grace
2:17.129 default P dimensional_rift Fluffy_Pillow 430444.4/1100000: 39% mana | 3.0/5: 60% soul_shard soul_harvest, lord_of_flames, embrace_chaos, nefarious_pact, potion_of_deadly_grace
2:17.936 default Q chaos_bolt Fluffy_Pillow 441939.3/1100000: 40% mana | 4.0/5: 80% soul_shard soul_harvest, lord_of_flames, embrace_chaos, nefarious_pact, potion_of_deadly_grace
2:18.904 default Q chaos_bolt Fluffy_Pillow 455824.8/1100000: 41% mana | 2.0/5: 40% soul_shard soul_harvest, lord_of_flames, embrace_chaos, nefarious_pact, accelerando, potion_of_deadly_grace
2:19.857 default K conflagrate Fluffy_Pillow 469604.5/1100000: 43% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, embrace_chaos, nefarious_pact, accelerando, potion_of_deadly_grace
2:20.653 default Q chaos_bolt Fluffy_Pillow 481114.0/1100000: 44% mana | 3.0/5: 60% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando, potion_of_deadly_grace
2:21.605 default Q chaos_bolt Fluffy_Pillow 494880.1/1100000: 45% mana | 2.0/5: 40% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(2), potion_of_deadly_grace
2:22.544 default R incinerate Fluffy_Pillow 508659.8/1100000: 46% mana | 0.0/5: 0% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(2), potion_of_deadly_grace
2:23.483 default R incinerate Fluffy_Pillow 456439.6/1100000: 41% mana | 0.0/5: 0% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(2), potion_of_deadly_grace
2:24.420 default C havoc enemy2 404189.9/1100000: 37% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(2), potion_of_deadly_grace
2:25.204 default Q chaos_bolt Fluffy_Pillow 327695.0/1100000: 30% mana | 2.0/5: 40% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(2), potion_of_deadly_grace
2:26.146 default K conflagrate Fluffy_Pillow 341689.1/1100000: 31% mana | 0.0/5: 0% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due, accelerando(4), potion_of_deadly_grace
2:27.440 default R incinerate Fluffy_Pillow 361236.0/1100000: 33% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due, accelerando(4), potion_of_deadly_grace
2:28.988 default R incinerate Fluffy_Pillow 318619.7/1100000: 29% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due, accelerando(4), potion_of_deadly_grace
2:30.538 default Q chaos_bolt Fluffy_Pillow 276165.6/1100000: 25% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, devils_due, potion_of_deadly_grace
2:33.271 default E immolate Fluffy_Pillow 315094.4/1100000: 29% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due, potion_of_deadly_grace
2:34.638 default Q chaos_bolt Fluffy_Pillow 268662.6/1100000: 24% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando, potion_of_deadly_grace
2:36.012 default R incinerate Fluffy_Pillow 288529.6/1100000: 26% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando, potion_of_deadly_grace
2:37.385 default R incinerate Fluffy_Pillow 242382.2/1100000: 22% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando, potion_of_deadly_grace
2:38.758 default R incinerate Fluffy_Pillow 196234.8/1100000: 18% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
2:40.132 default R incinerate Fluffy_Pillow 150101.9/1100000: 14% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, accelerando
2:41.507 default R incinerate Fluffy_Pillow 103983.4/1100000: 9% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, accelerando
2:42.883 default S life_tap Fluffy_Pillow 57879.3/1100000: 5% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, accelerando
2:44.027 default Q chaos_bolt Fluffy_Pillow 404442.5/1100000: 37% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, accelerando(2)
2:46.279 default C havoc enemy2 437451.6/1100000: 40% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos
2:47.443 default G immolate Fluffy_Pillow 366031.6/1100000: 33% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos
2:48.606 default J conflagrate Fluffy_Pillow 316597.3/1100000: 29% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos
2:49.769 default K conflagrate Fluffy_Pillow 333163.1/1100000: 30% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
2:50.930 default Q chaos_bolt Fluffy_Pillow 349719.7/1100000: 32% mana | 4.0/5: 80% soul_shard lord_of_flames, accelerando
2:53.216 default K conflagrate Fluffy_Pillow 382773.6/1100000: 35% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando
2:54.362 default Q chaos_bolt Fluffy_Pillow 399375.2/1100000: 36% mana | 3.0/5: 60% soul_shard lord_of_flames, embrace_chaos, accelerando(2)
2:55.713 default K conflagrate Fluffy_Pillow 419201.0/1100000: 38% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando(2)
2:56.843 default Q chaos_bolt Fluffy_Pillow 435857.6/1100000: 40% mana | 4.0/5: 80% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
2:58.176 default Q chaos_bolt Fluffy_Pillow 455811.9/1100000: 41% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(4)
2:59.491 default R incinerate Fluffy_Pillow 475676.0/1100000: 43% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(4)
3:00.804 default R incinerate Fluffy_Pillow 429509.9/1100000: 39% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(4)
3:02.117 default K conflagrate Fluffy_Pillow 383343.8/1100000: 35% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(4)
3:03.230 default P dimensional_rift Fluffy_Pillow 399820.4/1100000: 36% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
3:04.393 default H berserking Fluffy_Pillow 416386.2/1100000: 38% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos
3:04.393 default R incinerate Fluffy_Pillow 416386.2/1100000: 38% mana | 1.0/5: 20% soul_shard berserking, lord_of_flames, conflagration_of_chaos
3:05.606 default R incinerate Fluffy_Pillow 370255.8/1100000: 34% mana | 1.0/5: 20% soul_shard berserking, lord_of_flames, conflagration_of_chaos
3:06.819 default C havoc enemy2 324183.1/1100000: 29% mana | 1.0/5: 20% soul_shard berserking, lord_of_flames, conflagration_of_chaos, accelerando
3:07.817 default Q chaos_bolt Fluffy_Pillow 252778.1/1100000: 23% mana | 2.0/5: 40% soul_shard berserking, lord_of_flames, conflagration_of_chaos, accelerando
3:09.806 default R incinerate Fluffy_Pillow 285851.5/1100000: 26% mana | 1.0/5: 20% soul_shard berserking, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
3:11.000 default E immolate Fluffy_Pillow 239705.5/1100000: 22% mana | 2.0/5: 40% soul_shard berserking, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
3:11.999 default L service_imp Fluffy_Pillow 190317.1/1100000: 17% mana | 2.0/5: 40% soul_shard berserking, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
3:12.994 default R incinerate Fluffy_Pillow 206862.1/1100000: 19% mana | 1.0/5: 20% soul_shard berserking, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
3:14.188 default Q chaos_bolt Fluffy_Pillow 160716.1/1100000: 15% mana | 2.0/5: 40% soul_shard berserking, lord_of_flames, conflagration_of_chaos, nefarious_pact, accelerando
3:15.566 default R incinerate Fluffy_Pillow 181085.6/1100000: 16% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando
3:16.520 default R incinerate Fluffy_Pillow 128879.8/1100000: 12% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando
3:17.473 default R incinerate Fluffy_Pillow 76660.6/1100000: 7% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(2)
3:18.410 default S life_tap Fluffy_Pillow 24410.9/1100000: 2% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(2)
3:19.195 default G immolate Fluffy_Pillow 365668.3/1100000: 33% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact
3:20.001 default J conflagrate Fluffy_Pillow 311149.8/1100000: 28% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, nefarious_pact, accelerando
3:20.795 default K conflagrate Fluffy_Pillow 322630.5/1100000: 29% mana | 1.0/5: 20% soul_shard lord_of_flames, nefarious_pact, accelerando
3:21.592 default K conflagrate Fluffy_Pillow 334154.5/1100000: 30% mana | 2.0/5: 40% soul_shard lord_of_flames, nefarious_pact, accelerando
3:22.385 default Q chaos_bolt Fluffy_Pillow 345642.3/1100000: 31% mana | 5.0/5: 100% soul_shard lord_of_flames, conflagration_of_chaos, nefarious_pact, accelerando(2)
3:23.947 default Q chaos_bolt Fluffy_Pillow 368564.4/1100000: 34% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(2)
3:24.883 default R incinerate Fluffy_Pillow 382300.1/1100000: 35% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(2)
3:25.823 default Q chaos_bolt Fluffy_Pillow 330180.4/1100000: 30% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(3)
3:26.748 default R incinerate Fluffy_Pillow 343953.8/1100000: 31% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due, accelerando(3)
3:28.319 default C havoc enemy2 301346.3/1100000: 27% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due, accelerando(3)
3:29.627 default K conflagrate Fluffy_Pillow 232822.7/1100000: 21% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due, accelerando(3)
3:30.938 default Q chaos_bolt Fluffy_Pillow 252343.7/1100000: 23% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, devils_due, accelerando(3)
3:33.553 default K conflagrate Fluffy_Pillow 290276.9/1100000: 26% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due, accelerando
3:35.129 default Q chaos_bolt Fluffy_Pillow 313064.7/1100000: 28% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
3:36.501 default Q chaos_bolt Fluffy_Pillow 332910.9/1100000: 30% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
3:37.855 default R incinerate Fluffy_Pillow 352780.6/1100000: 32% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
3:39.211 default Q chaos_bolt Fluffy_Pillow 306779.9/1100000: 28% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
3:40.544 default R incinerate Fluffy_Pillow 326628.5/1100000: 30% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
3:41.877 default E immolate Fluffy_Pillow 280477.1/1100000: 25% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
3:42.990 default R incinerate Fluffy_Pillow 231051.0/1100000: 21% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(4)
3:44.304 default R incinerate Fluffy_Pillow 184900.0/1100000: 17% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(4)
3:45.618 default Q chaos_bolt Fluffy_Pillow 138689.5/1100000: 13% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos
3:47.940 default P dimensional_rift Fluffy_Pillow 171764.0/1100000: 16% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
3:49.102 default C havoc enemy2 188315.5/1100000: 17% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
3:50.264 default Q chaos_bolt Fluffy_Pillow 116867.0/1100000: 11% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
3:51.656 default G immolate Fluffy_Pillow 136694.6/1100000: 12% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
3:52.819 default J conflagrate Fluffy_Pillow 87454.0/1100000: 8% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
3:53.948 default K conflagrate Fluffy_Pillow 104022.0/1100000: 9% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando(2)
3:55.076 default N summon_doomguard Fluffy_Pillow 120818.1/1100000: 11% mana | 3.0/5: 60% soul_shard lord_of_flames, embrace_chaos, accelerando(3)
3:56.188 default K conflagrate Fluffy_Pillow 137376.0/1100000: 12% mana | 2.0/5: 40% soul_shard lord_of_flames, sindorei_spite, accelerando(3)
3:57.301 default Q chaos_bolt Fluffy_Pillow 154188.7/1100000: 14% mana | 4.0/5: 80% soul_shard lord_of_flames, sindorei_spite, accelerando(4)
3:59.491 default Q chaos_bolt Fluffy_Pillow 187392.0/1100000: 17% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, sindorei_spite, accelerando(5)
4:00.786 default K conflagrate Fluffy_Pillow 207232.9/1100000: 19% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos, sindorei_spite, accelerando(5)
4:01.866 default R incinerate Fluffy_Pillow 223779.6/1100000: 20% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, sindorei_spite, accelerando(5)
4:03.163 default R incinerate Fluffy_Pillow 177651.1/1100000: 16% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, sindorei_spite, accelerando(5)
4:04.460 default R incinerate Fluffy_Pillow 131254.4/1100000: 12% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, sindorei_spite, accelerando
4:05.834 default R incinerate Fluffy_Pillow 85121.4/1100000: 8% mana | 1.0/5: 20% soul_shard lord_of_flames, sindorei_spite, accelerando
4:07.208 default K conflagrate Fluffy_Pillow 38988.5/1100000: 4% mana | 1.0/5: 20% soul_shard lord_of_flames, sindorei_spite, accelerando
4:08.354 default O soul_harvest Fluffy_Pillow 55558.8/1100000: 5% mana | 2.0/5: 40% soul_shard lord_of_flames, sindorei_spite, accelerando
4:08.354 default Q chaos_bolt Fluffy_Pillow 55558.8/1100000: 5% mana | 2.0/5: 40% soul_shard soul_harvest, lord_of_flames, sindorei_spite, accelerando
4:10.642 default C havoc enemy2 88784.4/1100000: 8% mana | 0.0/5: 0% soul_shard soul_harvest, lord_of_flames, embrace_chaos, sindorei_spite, accelerando(2)
4:11.772 default S life_tap Fluffy_Pillow 17367.0/1100000: 2% mana | 0.0/5: 0% soul_shard soul_harvest, lord_of_flames, embrace_chaos, sindorei_spite, accelerando(2)
4:12.900 default R incinerate Fluffy_Pillow 363920.2/1100000: 33% mana | 0.0/5: 0% soul_shard soul_harvest, lord_of_flames, embrace_chaos, sindorei_spite, accelerando(2)
4:14.255 default E immolate Fluffy_Pillow 317804.7/1100000: 29% mana | 0.0/5: 0% soul_shard soul_harvest, lord_of_flames, embrace_chaos, sindorei_spite, accelerando(2)
4:15.382 default R incinerate Fluffy_Pillow 268483.7/1100000: 24% mana | 0.0/5: 0% soul_shard soul_harvest, lord_of_flames, sindorei_spite, accelerando(3)
4:16.716 default R incinerate Fluffy_Pillow 222178.5/1100000: 20% mana | 0.0/5: 0% soul_shard soul_harvest, lord_of_flames, sindorei_spite
4:18.111 default R incinerate Fluffy_Pillow 176048.9/1100000: 16% mana | 0.0/5: 0% soul_shard soul_harvest, lord_of_flames, sindorei_spite
4:19.507 default R incinerate Fluffy_Pillow 129933.4/1100000: 12% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, sindorei_spite
4:20.903 default R incinerate Fluffy_Pillow 83818.0/1100000: 8% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames
4:22.296 default S life_tap Fluffy_Pillow 37660.5/1100000: 3% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, accelerando
4:23.441 default R incinerate Fluffy_Pillow 384216.4/1100000: 35% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, accelerando
4:24.814 default R incinerate Fluffy_Pillow 338069.9/1100000: 31% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, accelerando(2)
4:26.169 default G immolate Fluffy_Pillow 292132.0/1100000: 27% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, accelerando(3)
4:27.282 default J conflagrate Fluffy_Pillow 242705.8/1100000: 22% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, accelerando(4)
4:28.379 default K conflagrate Fluffy_Pillow 259276.9/1100000: 24% mana | 2.0/5: 40% soul_shard lord_of_flames, accelerando(4)
4:29.476 default Q chaos_bolt Fluffy_Pillow 275847.9/1100000: 25% mana | 3.0/5: 60% soul_shard lord_of_flames, accelerando(4)
4:31.664 default C havoc enemy2 308899.4/1100000: 28% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando(4)
4:32.760 default K conflagrate Fluffy_Pillow 237455.3/1100000: 22% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando(4)
4:33.859 default K conflagrate Fluffy_Pillow 254056.6/1100000: 23% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando(4)
4:35.050 default P dimensional_rift Fluffy_Pillow 271395.2/1100000: 25% mana | 3.0/5: 60% soul_shard lord_of_flames, embrace_chaos
4:36.212 default Q chaos_bolt Fluffy_Pillow 287946.7/1100000: 26% mana | 3.0/5: 60% soul_shard lord_of_flames
4:38.531 default Q chaos_bolt Fluffy_Pillow 320979.1/1100000: 29% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando
4:39.904 default R incinerate Fluffy_Pillow 340831.7/1100000: 31% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando
4:41.277 default J conflagrate Fluffy_Pillow 294684.3/1100000: 27% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando
4:42.422 default L service_imp Fluffy_Pillow 311240.1/1100000: 28% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
4:43.567 default Q chaos_bolt Fluffy_Pillow 327796.0/1100000: 30% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
4:44.941 default R incinerate Fluffy_Pillow 347663.1/1100000: 32% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
4:46.314 default R incinerate Fluffy_Pillow 301516.5/1100000: 27% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
4:47.668 default J conflagrate Fluffy_Pillow 255386.3/1100000: 23% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
4:48.800 default E immolate Fluffy_Pillow 271998.3/1100000: 25% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
4:49.928 default R incinerate Fluffy_Pillow 222551.5/1100000: 20% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, accelerando(2)
4:51.281 default P dimensional_rift Fluffy_Pillow 176082.2/1100000: 16% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos
4:52.443 default C havoc enemy2 192633.7/1100000: 18% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos
4:53.606 default Q chaos_bolt Fluffy_Pillow 121199.4/1100000: 11% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos
4:55.927 default J conflagrate Fluffy_Pillow 154555.7/1100000: 14% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
4:57.073 default Q chaos_bolt Fluffy_Pillow 171126.1/1100000: 16% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando
4:58.447 default R incinerate Fluffy_Pillow 190993.1/1100000: 17% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos, accelerando
4:59.820 default R incinerate Fluffy_Pillow 144845.7/1100000: 13% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos, accelerando
5:01.193 default R incinerate Fluffy_Pillow 98698.3/1100000: 9% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos, accelerando

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4201 3876 0
Agility 7254 6929 0
Stamina 52586 52586 34192
Intellect 50353 48647 39007 (1278)
Spirit 1 1 0
Health 3155160 3155160 0
Mana 1100000 1100000 0
Soul Shard 5 5 0
Spell Power 50353 48647 0
Crit 15.68% 15.68% 4271
Haste 29.49% 28.49% 10684
Damage / Heal Versatility 5.36% 5.36% 2544
ManaReg per Second 14244 14134 0
Mastery 66.15% 66.15% 5618
Armor 1975 1975 1975
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 906.00
Local Head Eyes of Azj'Aqir
ilevel: 900, stats: { 253 Armor, +3255 Sta, +2170 Int, +1074 Haste, +578 Vers }
Local Neck Radiant String of Scorpid Eyes
ilevel: 900, stats: { +1831 Sta, +2011 Haste, +922 Crit }, enchant: mark_of_the_hidden_satyr
Local Shoulders Pauldrons of Azj'Aqir
ilevel: 900, stats: { 233 Armor, +2442 Sta, +1628 Int, +752 Mastery, +487 Vers }
Local Chest Robes of Fluctuating Energy
ilevel: 900, stats: { 311 Armor, +3255 Sta, +2170 Int, +1145 Haste, +507 Mastery }
Local Waist Man'ari Skullbuckled Cinch
ilevel: 900, stats: { 175 Armor, +2442 Sta, +1628 Int, +699 Haste, +540 Mastery }
Local Legs Leggings of Azj'Aqir
ilevel: 900, stats: { 272 Armor, +3255 Sta, +2170 Int, +932 Crit, +720 Haste }
Local Feet Outcast Wanderer's Footrags
ilevel: 910, stats: { 222 Armor, +2680 Sta, +1786 Int, +864 Crit, +422 Mastery }
Local Wrists Sin'dorei Spite
ilevel: 940, stats: { 157 Armor, +2658 Sta, +1772 Int, +694 Crit, +385 Haste }
Local Hands Clutch of Azj'Aqir
ilevel: 900, stats: { 194 Armor, +2442 Sta, +1628 Int, +859 Crit, +380 Mastery }
Local Finger1 Ring of the Scoured Clan
ilevel: 900, stats: { +1831 Sta, +2095 Mastery, +838 Haste }, enchant: { +200 Haste }
Local Finger2 Ring of Braided Stems
ilevel: 905, stats: { +1918 Sta, +1814 Haste, +1209 Vers }, enchant: { +200 Haste }
Local Trinket1 Whispers in the Dark
ilevel: 905, stats: { +2162 Int }
Local Trinket2 Erratic Metronome
ilevel: 900, stats: { +2063 Int }
Local Back Astromancer's Greatcloak
ilevel: 905, stats: { 158 Armor, +1918 Sta, +1278 StrAgiInt, +676 Haste, +270 Vers }, enchant: { +200 Int }
Local Main Hand Scepter of Sargeras
ilevel: 929, weapon: { 7005 - 10509, 3.6 }, stats: { +2843 Int, +4265 Sta, +922 Haste, +922 Mastery, +15509 Int }, relics: { +61 ilevels, +59 ilevels, +61 ilevels }

Talents

Level
15 Backdraft (Destruction Warlock) Roaring Blaze (Destruction Warlock) Shadowburn (Destruction Warlock)
30 Reverse Entropy (Destruction Warlock) Eradication (Destruction Warlock) Empowered Life Tap
45 Demonic Circle Mortal Coil Shadowfury
60 Cataclysm (Destruction Warlock) Fire and Brimstone (Destruction Warlock) Soul Harvest
75 Demon Skin Burning Rush Dark Pact
90 Grimoire of Supremacy Grimoire of Service Grimoire of Sacrifice
100 Wreak Havoc (Destruction Warlock) Channel Demonfire (Destruction Warlock) Soul Conduit

Profile

warlock="Spite"
level=110
race=troll
role=spell
position=back
talents=2203021
artifact=38:142513:142516:142513:0:803:1:804:3:805:3:806:5:807:3:808:3:809:4:810:3:811:3:812:3:813:1:814:1:815:1:816:1:817:1:818:1:1355:1
spec=destruction

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,type=whispered_pact
actions.precombat+=/food,type=azshari_salad
actions.precombat+=/summon_pet,if=!talent.grimoire_of_supremacy.enabled&(!talent.grimoire_of_sacrifice.enabled|buff.demonic_power.down)
actions.precombat+=/summon_infernal,if=talent.grimoire_of_supremacy.enabled&artifact.lord_of_flames.rank>0
actions.precombat+=/summon_infernal,if=talent.grimoire_of_supremacy.enabled&active_enemies>1
actions.precombat+=/summon_doomguard,if=talent.grimoire_of_supremacy.enabled&active_enemies=1&artifact.lord_of_flames.rank=0
actions.precombat+=/augmentation,type=defiled
actions.precombat+=/snapshot_stats
actions.precombat+=/grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
actions.precombat+=/life_tap,if=talent.empowered_life_tap.enabled&!buff.empowered_life_tap.remains
actions.precombat+=/potion,name=prolonged_power
actions.precombat+=/chaos_bolt

# Executed every time the actor is available.
actions=havoc,target=2,if=active_enemies>1&(active_enemies<4|talent.wreak_havoc.enabled&active_enemies<6)&!debuff.havoc.remains
actions+=/dimensional_rift,if=charges=3
actions+=/immolate,if=remains<=tick_time
actions+=/immolate,cycle_targets=1,if=active_enemies>1&remains<=tick_time&(!talent.roaring_blaze.enabled|(!debuff.roaring_blaze.remains&action.conflagrate.charges<2))
actions+=/immolate,if=talent.roaring_blaze.enabled&remains<=duration&!debuff.roaring_blaze.remains&target.time_to_die>10&(action.conflagrate.charges=2+set_bonus.tier19_4pc|(action.conflagrate.charges>=1+set_bonus.tier19_4pc&action.conflagrate.recharge_time<cast_time+gcd)|target.time_to_die<24)
actions+=/berserking
actions+=/blood_fury
actions+=/arcane_torrent
actions+=/potion,name=deadly_grace,if=(buff.soul_harvest.remains|trinket.proc.any.react|target.time_to_die<=45)
actions+=/shadowburn,if=buff.conflagration_of_chaos.remains<=action.chaos_bolt.cast_time
actions+=/shadowburn,if=(charges=1&recharge_time<action.chaos_bolt.cast_time|charges=2)&soul_shard<5
actions+=/conflagrate,if=talent.roaring_blaze.enabled&(charges=2+set_bonus.tier19_4pc|(charges>=1+set_bonus.tier19_4pc&recharge_time<gcd)|target.time_to_die<24)
actions+=/conflagrate,if=talent.roaring_blaze.enabled&debuff.roaring_blaze.stack>0&dot.immolate.remains>dot.immolate.duration*0.3&(active_enemies=1|soul_shard<3)&soul_shard<5
actions+=/conflagrate,if=!talent.roaring_blaze.enabled&!buff.backdraft.remains&buff.conflagration_of_chaos.remains<=action.chaos_bolt.cast_time
actions+=/conflagrate,if=!talent.roaring_blaze.enabled&!buff.backdraft.remains&(charges=1&recharge_time<action.chaos_bolt.cast_time|charges=2)&soul_shard<5
actions+=/life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<=gcd
actions+=/dimensional_rift,if=equipped.144369&!buff.lessons_of_spacetime.remains&((!talent.grimoire_of_supremacy.enabled&!cooldown.summon_doomguard.remains)|(talent.grimoire_of_service.enabled&!cooldown.service_pet.remains)|(talent.soul_harvest.enabled&!cooldown.soul_harvest.remains))
actions+=/service_pet
actions+=/summon_infernal,if=artifact.lord_of_flames.rank>0&!buff.lord_of_flames.remains
actions+=/summon_doomguard,if=!talent.grimoire_of_supremacy.enabled&spell_targets.infernal_awakening<=2&(target.time_to_die>180|target.health.pct<=20|target.time_to_die<30)
actions+=/summon_infernal,if=!talent.grimoire_of_supremacy.enabled&spell_targets.infernal_awakening>2
actions+=/summon_doomguard,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal=1&artifact.lord_of_flames.rank>0&buff.lord_of_flames.remains&!pet.doomguard.active
actions+=/summon_doomguard,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal=1&equipped.132379&!cooldown.sindorei_spite_icd.remains
actions+=/summon_infernal,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal>1&equipped.132379&!cooldown.sindorei_spite_icd.remains
actions+=/soul_harvest
actions+=/channel_demonfire,if=dot.immolate.remains>cast_time
actions+=/havoc,if=active_enemies=1&talent.wreak_havoc.enabled&equipped.132375&!debuff.havoc.remains
actions+=/rain_of_fire,if=active_enemies>=3&cooldown.havoc.remains<=12&!talent.wreak_havoc.enabled
actions+=/rain_of_fire,if=active_enemies>=6&talent.wreak_havoc.enabled
actions+=/dimensional_rift,if=!equipped.144369|charges>1|((!talent.grimoire_of_service.enabled|recharge_time<cooldown.service_pet.remains)&(!talent.soul_harvest.enabled|recharge_time<cooldown.soul_harvest.remains)&(!talent.grimoire_of_supremacy.enabled|recharge_time<cooldown.summon_doomguard.remains))
actions+=/life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<duration*0.3
actions+=/cataclysm
actions+=/chaos_bolt,if=(cooldown.havoc.remains>12&cooldown.havoc.remains|active_enemies<3|talent.wreak_havoc.enabled&active_enemies<6)
actions+=/shadowburn
actions+=/conflagrate,if=!talent.roaring_blaze.enabled&!buff.backdraft.remains
actions+=/immolate,if=!talent.roaring_blaze.enabled&remains<=duration*0.3
actions+=/incinerate
actions+=/life_tap

head=eyes_of_azjaqir,id=138314,bonus_id=3445
neck=radiant_string_of_scorpid_eyes,id=140898,bonus_id=3445,enchant_id=5439
shoulders=pauldrons_of_azjaqir,id=138323,bonus_id=3445
back=astromancers_greatcloak,id=140909,bonus_id=3518,enchant_id=5436
chest=robes_of_fluctuating_energy,id=140848,bonus_id=3445
wrists=sindorei_spite,id=132379,ilevel=940
hands=clutch_of_azjaqir,id=138311,bonus_id=3445
waist=manari_skullbuckled_cinch,id=140887,bonus_id=3445
legs=leggings_of_azjaqir,id=138317,bonus_id=3445
feet=outcast_wanderers_footrags,id=140914,bonus_id=3519
finger1=ring_of_the_scoured_clan,id=140897,bonus_id=3445,enchant=binding_of_haste
finger2=ring_of_braided_stems,id=140896,bonus_id=3518,enchant=binding_of_haste
trinket1=whispers_in_the_dark,id=140809,ilevel=905
trinket2=erratic_metronome,id=140792,ilevel=900
main_hand=scepter_of_sargeras,id=128941,ilevel=929,gem_id=140826/140837/140826,relic_id=3519/3518:3518/3519

# Gear Summary
# gear_ilvl=906.27
# gear_stamina=34192
# gear_intellect=39007
# gear_crit_rating=4271
# gear_haste_rating=10684
# gear_mastery_rating=5618
# gear_versatility_rating=2544
# gear_armor=1975
# set_bonus=tier19_2pc=1
# set_bonus=tier19_4pc=1
default_pet=imp

Warlock_Destruction_T19M : 970635 dps, 568907 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
970635.0 970635.0 0.0 / 0.000% 0.0 / 0.0% 30.0
RPS Out RPS In Primary Resource Waiting APM Active Skill
26485.0 26485.0 Mana 0.00% 50.9 100.0% 100%
Talents
  • 15: Roaring Blaze (Destruction Warlock)
  • 30: Eradication (Destruction Warlock)
  • 60: Soul Harvest
  • 90: Grimoire of Service
  • 100: Wreak Havoc (Destruction Warlock)
  • Talent Calculator
Artifact

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Warlock_Destruction_T19M 970635
Chaos Bolt 312175 32.2% 57.6 5.08sec 1630751 1078146 Direct 110.1 0 853044 853044 100.0%  

Stats details: chaos_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 57.57 110.06 0.00 0.00 1.5126 0.0000 93887145.01 93887145.01 0.00 1078146.40 1078146.40
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 110.06 100.00% 853043.69 558971 1314033 853320.76 798025 923890 93887145 93887145 0.00
 
 

Action details: chaos_bolt

Static Values
  • id:116858
  • school:chromatic
  • resource:soul_shard
  • range:40.0
  • travel_speed:16.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:2.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:116858
  • name:Chaos Bolt
  • school:chromatic
  • tooltip:
  • description:Unleashes a devastating blast of chaos, causing {$s1=1} Chaos damage. Chaos Bolt always critically strikes and your critical strike chance increases its damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:4.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Conflagrate 105347 10.9% 48.6 6.18sec 651739 629694 Direct 96.6 195071 438426 327797 54.5%  

Stats details: conflagrate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 48.56 96.55 0.00 0.00 1.0350 0.0000 31650322.52 31650322.52 0.00 629694.26 629694.26
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 43.89 45.46% 195071.39 129233 303802 195174.92 172863 217761 8562119 8562119 0.00
crit 52.66 54.54% 438425.65 258478 692304 438586.42 397066 481491 23088203 23088203 0.00
 
 

Action details: conflagrate

Static Values
  • id:17962
  • school:fire
  • resource:chi
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:9.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.roaring_blaze.enabled&(charges=2+set_bonus.tier19_4pc|(charges>=1+set_bonus.tier19_4pc&recharge_time<gcd)|target.time_to_die<24)
Spelldata
  • id:17962
  • name:Conflagrate
  • school:fire
  • tooltip:
  • description:Triggers an explosion on the target, dealing {$s1=1} Fire damage.{$?s196406=false}[ Reduces the cast time of Incinerate and Chaos Bolt by {$117828s1=30}% for {$117828d=10 seconds}.][] |cFFFFFFFFGenerates 1 Soul Shard.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.265510
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Deadly Grace 5211 0.5% 14.3 2.08sec 107823 0 Direct 14.3 94593 189257 107820 14.0%  

Stats details: deadly_grace

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.27 14.27 0.00 0.00 0.0000 0.0000 1538545.89 1538545.89 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 12.28 86.03% 94593.09 83888 100666 94604.03 86685 100666 1161145 1161145 0.00
crit 1.99 13.97% 189257.43 167777 201332 165074.73 0 201332 377401 377401 0.00
 
 

Action details: deadly_grace

Static Values
  • id:188091
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:25.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188091
  • name:Deadly Grace
  • school:arcane
  • tooltip:
  • description:Deal {$s1=63339 to 95008} Arcane damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:63338.72
  • base_dd_max:95008.08
 
Immolate 233423 24.1% 20.0 15.16sec 3500956 3341881 Direct 38.7 134406 269032 196292 46.0%  
Periodic 295.0 145231 290553 211974 45.9% 195.9%

Stats details: immolate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 20.03 38.72 295.02 295.02 1.0476 1.9996 70136058.79 70136058.79 0.00 114810.39 3341881.11
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 20.92 54.03% 134406.29 89662 210757 134383.27 113859 153290 2811811 2811811 0.00
crit 17.80 45.97% 269032.27 179320 421513 269015.02 228437 313692 4788343 4788343 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 159.5 54.07% 145231.02 27 418760 145457.42 122457 169689 23167248 23167248 0.00
crit 135.5 45.93% 290552.59 75 837523 290965.06 250371 339678 39368656 39368656 0.00
 
 

Action details: immolate

Static Values
  • id:348
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:66000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.32
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:remains<=tick_time
Spelldata
  • id:348
  • name:Immolate
  • school:fire
  • tooltip:
  • description:Burns the enemy, causing {$s1=1} Fire damage immediately and an additional $157736o1 Fire damage over {$157736d=18 seconds}. |cFFFFFFFFPeriodic damage has a {$193541s1=15}% chance to generate 1 Soul Shard. Chance doubled on critical strikes.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.332000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.721500
  • base_td:0.00
  • dot_duration:18.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Incinerate 131010 13.5% 80.9 3.54sec 487199 397441 Direct 154.8 223480 447338 254808 14.0%  

Stats details: incinerate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 80.94 154.76 0.00 0.00 1.2258 0.0000 39434897.65 39434897.65 0.00 397441.07 397441.07
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 133.11 86.01% 223479.94 144936 340714 223555.21 211077 237940 29746468 29746468 0.00
crit 21.66 13.99% 447337.88 289878 681425 447415.91 383670 519715 9688430 9688430 0.00
 
 

Action details: incinerate

Static Values
  • id:29722
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:66000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:29722
  • name:Incinerate
  • school:fire
  • tooltip:
  • description:Draws fire toward the enemy, dealing {$s2=0} Fire damage.{$?s29722=true}|!c3[][ Replaces Shadow Bolt.]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.331000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Mark of the Hidden Satyr 8734 0.9% 20.0 14.88sec 130980 0 Direct 20.0 115108 230139 130980 13.8%  

Stats details: mark_of_the_hidden_satyr

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 20.05 20.05 0.00 0.00 0.0000 0.0000 2626074.94 2626074.94 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 17.28 86.20% 115107.87 109698 138580 115138.14 109698 124922 1989423 1989423 0.00
crit 2.77 13.80% 230138.67 219396 277160 217074.65 0 277160 636652 636652 0.00
 
 

Action details: mark_of_the_hidden_satyr

Static Values
  • id:191259
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191259
  • name:Mark of the Hidden Satyr
  • school:fire
  • tooltip:
  • description:Deals fire damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:2.500000
  • spell_power_mod.direct:2.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
pet - imp 41611 / 41611
Firebolt 41611 4.3% 109.2 2.76sec 114521 94478 Direct 108.4 101305 202632 115409 13.9%  

Stats details: firebolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 109.21 108.37 0.00 0.00 1.2122 0.0000 12507234.53 12507234.53 0.00 94477.65 94477.65
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 93.29 86.08% 101305.12 64723 122646 101332.73 99152 103427 9450529 9450529 0.00
crit 15.09 13.92% 202631.51 129446 245291 202688.71 173059 232504 3056706 3056706 0.00
 
 

Action details: firebolt

Static Values
  • id:3110
  • school:fire
  • resource:energy
  • range:40.0
  • travel_speed:16.0000
  • trigger_gcd:0.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.75
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:3110
  • name:Firebolt
  • school:fire
  • tooltip:
  • description:Deals {$s1=1} Fire damage to a target.$?a231795[ Damage increased by {$231795s1=50}% if you have Immolated the target.][] |cFF777777(Right-Click to toggle)|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
pet - service_imp 120540 / 38446
Firebolt 120540 4.0% 49.3 5.53sec 233911 205316 Direct 49.0 206719 413146 235297 13.8%  

Stats details: firebolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 49.26 48.97 0.00 0.00 1.1393 0.0000 11522959.80 11522959.80 0.00 205316.18 205316.18
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 42.19 86.16% 206718.52 129446 245291 206921.53 198862 213938 8722101 8722101 0.00
crit 6.78 13.84% 413146.36 258893 490583 413004.24 0 490583 2800859 2800859 0.00
 
 

Action details: firebolt

Static Values
  • id:3110
  • school:fire
  • resource:energy
  • range:40.0
  • travel_speed:16.0000
  • trigger_gcd:0.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.75
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:3110
  • name:Firebolt
  • school:fire
  • tooltip:
  • description:Deals {$s1=1} Fire damage to a target.$?a231795[ Damage increased by {$231795s1=50}% if you have Immolated the target.][] |cFF777777(Right-Click to toggle)|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
pet - infernal 114079 / 9661
Immolation 88883 0.8% 1.0 0.00sec 2222153 0 Periodic 46.6 41809 83598 47646 14.0% 8.1%

Stats details: immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 23.32 46.64 0.0000 1.0422 2222153.32 2222153.32 0.00 91435.35 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 40.1 86.03% 41808.97 36089 43306 41814.69 40682 42882 1677563 1677563 0.00
crit 6.5 13.97% 83598.43 72177 86613 83544.67 0 86613 544590 544590 0.00
 
 

Action details: immolation

Static Values
  • id:19483
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!ticking
Spelldata
  • id:19483
  • name:Immolation
  • school:fire
  • tooltip:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
 

Action details: immolation_tick

Static Values
  • id:20153
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all enemies near the caster.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
melee 25196 0.2% 22.1 1.10sec 28533 26015 Direct 22.1 25038 50102 28534 13.9%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.08 22.08 0.00 0.00 1.0968 0.0000 629934.05 926062.73 31.98 26015.28 26015.28
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 19.00 86.05% 25038.20 21581 25897 25038.56 24356 25897 475681 699296 31.98
crit 3.08 13.95% 50101.67 43162 51795 48167.42 0 51795 154253 226767 30.74
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
pet - doomguard 94142 / 7963
Doom Bolt 94142 0.8% 11.0 2.19sec 213296 99247 Direct 11.0 187093 374031 213311 14.0%  

Stats details: doom_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.03 11.03 0.00 0.00 2.1492 0.0000 2353639.83 2353639.83 0.00 99246.88 99246.88
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 9.49 85.98% 187093.42 181003 217204 187102.01 181003 217204 1774951 1774951 0.00
crit 1.55 14.02% 374031.32 362007 434408 302006.88 0 434408 578689 578689 0.00
 
 

Action details: doom_bolt

Static Values
  • id:85692
  • school:shadow
  • resource:energy
  • range:30.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:35.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:85692
  • name:Doom Bolt
  • school:shadow
  • tooltip:
  • description:Sends a shadowy bolt at the enemy, causing {$s1=1} Shadow damage. Deals {$s2=20}% additional damage to targets below 20% health.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
pet - lord_of_flames_infernal 114075 / 9662
Immolation 88860 0.8% 1.0 0.00sec 2221594 0 Periodic 46.6 41810 83583 47634 13.9% 8.1%

Stats details: immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 23.32 46.64 0.0000 1.0422 2221593.89 2221593.89 0.00 91412.33 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 40.1 86.06% 41810.22 36089 43306 41815.54 40621 42791 1678123 1678123 0.00
crit 6.5 13.94% 83582.88 72177 86613 83522.39 0 86613 543471 543471 0.00
 
 

Action details: immolation

Static Values
  • id:19483
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!ticking
Spelldata
  • id:19483
  • name:Immolation
  • school:fire
  • tooltip:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
 

Action details: immolation_tick

Static Values
  • id:20153
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all enemies near the caster.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
melee 25215 0.2% 22.1 1.10sec 28554 26034 Direct 22.1 25039 50097 28554 14.0%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.08 22.08 0.00 0.00 1.0968 0.0000 630389.46 926732.21 31.98 26034.09 26034.09
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 18.98 85.97% 25038.55 21581 25897 25038.82 24356 25897 475225 698626 31.98
crit 3.10 14.03% 50097.24 43162 51795 48362.93 0 51795 155164 228106 30.87
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
pet - lord_of_flames_infernal 114088 / 9662
Immolation 88888 0.8% 1.0 0.00sec 2222285 0 Periodic 46.6 41808 83608 47649 14.0% 8.1%

Stats details: immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 23.32 46.64 0.0000 1.0422 2222284.70 2222284.70 0.00 91440.76 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 40.1 86.03% 41808.19 36089 43306 41813.30 40600 42814 1677432 1677432 0.00
crit 6.5 13.97% 83607.96 72177 86613 83548.79 0 86613 544853 544853 0.00
 
 

Action details: immolation

Static Values
  • id:19483
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!ticking
Spelldata
  • id:19483
  • name:Immolation
  • school:fire
  • tooltip:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
 

Action details: immolation_tick

Static Values
  • id:20153
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all enemies near the caster.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
melee 25200 0.2% 22.1 1.10sec 28538 26019 Direct 22.1 25041 50062 28538 14.0%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.08 22.08 0.00 0.00 1.0968 0.0000 630032.90 926208.05 31.98 26019.36 26019.36
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 18.99 86.03% 25041.42 21581 25897 25041.74 24356 25897 475582 699150 31.98
crit 3.09 13.97% 50062.06 43162 51795 48296.25 0 51795 154451 227058 30.84
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
pet - lord_of_flames_infernal 114045 / 9658
Immolation 88861 0.8% 1.0 0.00sec 2221614 0 Periodic 46.6 41803 83673 47634 13.9% 8.1%

Stats details: immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 23.32 46.64 0.0000 1.0422 2221614.10 2221614.10 0.00 91413.16 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 40.1 86.07% 41802.90 36089 43306 41808.17 40780 42825 1678102 1678102 0.00
crit 6.5 13.93% 83673.43 72177 86613 83600.25 0 86613 543512 543512 0.00
 
 

Action details: immolation

Static Values
  • id:19483
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!ticking
Spelldata
  • id:19483
  • name:Immolation
  • school:fire
  • tooltip:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
 

Action details: immolation_tick

Static Values
  • id:20153
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all enemies near the caster.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
melee 25184 0.2% 22.1 1.10sec 28520 26003 Direct 22.1 25044 50034 28520 13.9%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.08 22.08 0.00 0.00 1.0968 0.0000 629629.73 925615.34 31.98 26002.71 26002.71
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 19.01 86.09% 25043.65 21581 25897 25044.03 24356 25897 475985 699743 31.98
crit 3.07 13.91% 50034.37 43162 51795 48121.22 0 51795 153645 225872 30.76
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
pet - shadowy_tear 119984 / 20389
Shadow Bolt 119984 2.1% 4.4 59.24sec 1385521 0 Periodic 48.7 110003 220001 125310 13.9% 19.9%

Stats details: shadow_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.40 0.00 48.94 48.66 0.0000 1.2239 6098021.58 6098021.58 0.00 101808.46 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 41.9 86.09% 110003.39 70 133251 109834.63 0 133251 4608325 4608325 0.00
crit 6.8 13.91% 220001.22 139 266503 216223.31 0 266503 1489696 1489696 0.00
 
 

Action details: shadow_bolt

Static Values
  • id:196657
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:196657
  • name:Shadow Bolt
  • school:shadow
  • tooltip:
  • description:Sends a shadowy bolt at the enemy, causing {$s1=1} Shadow damage.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:14.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
pet - chaos_tear 135797 / 9442
Chaos Bolt 135797 1.0% 4.4 58.42sec 643628 325876 Direct 4.4 0 647907 647907 100.0%  

Stats details: chaos_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.40 4.37 0.00 0.00 1.9751 0.0000 2830561.51 2830561.51 0.00 325876.30 325876.30
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 4.37 100.00% 647906.91 600929 759145 648469.92 0 759145 2830562 2830562 0.00
 
 

Action details: chaos_bolt

Static Values
  • id:215279
  • school:chromatic
  • resource:none
  • range:100.0
  • travel_speed:16.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:5.500
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:215279
  • name:Chaos Bolt
  • school:chromatic
  • tooltip:
  • description:Unleashes a devastating blast of chaos, causing {$s1=1} Chaos damage. Chaos Bolt always critically strikes and your critical strike chance increases its damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:5.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
pet - chaos_portal 244404 / 18607
Chaos Barrage 244404 1.9% 4.4 58.36sec 1250978 0 Periodic 156.4 31249 62496 35595 13.9% 8.0%

Stats details: chaos_barrage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.45 0.00 157.10 156.35 0.0000 0.1540 5565340.46 5565340.46 0.00 230115.38 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 134.6 86.09% 31249.49 131 36645 31212.28 27672 36645 4206473 4206473 0.00
crit 21.7 13.91% 62496.14 287 73290 62386.10 0 73290 1358867 1358867 0.00
 
 

Action details: chaos_barrage

Static Values
  • id:187394
  • school:magic
  • resource:none
  • range:100.0
  • travel_speed:24.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:187394
  • name:Chaos Barrage
  • school:magic
  • tooltip:
  • description:Deals {$s1=1} Chaos damage.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:5.50
  • base_tick_time:0.25
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Simple Action Stats Execute Interval
Warlock_Destruction_T19M
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Warlock_Destruction_T19M
  • harmful:false
  • if_expr:
 
Berserking 2.1 180.70sec

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.08 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=15}%.
  • description:Increases your haste by {$s1=15}% for {$d=10 seconds}.
 
Dimensional Rift 13.2 23.16sec

Stats details: dimensional_rift

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.18 0.00 0.00 0.00 1.0070 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: dimensional_rift

Static Values
  • id:196586
  • school:none
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:45.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:charges=3
Spelldata
  • id:196586
  • name:Dimensional Rift
  • school:chaos
  • tooltip:
  • description:Rips a hole in time and space, opening a portal that damages your target.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Warlock_Destruction_T19M
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Warlock_Destruction_T19M
  • harmful:false
  • if_expr:
 
Havoc 14.9 20.91sec

Stats details: havoc

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.90 0.00 0.00 0.00 1.0643 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: havoc

Static Values
  • id:80240
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:88000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies>1&(active_enemies<4|talent.wreak_havoc.enabled&active_enemies<6)&!debuff.havoc.remains
Spelldata
  • id:80240
  • name:Havoc
  • school:shadow
  • tooltip:Spells cast by the Warlock also hit this target.
  • description:Marks a target with Havoc for {$d=8 seconds}, causing your single target spells to also strike the Havoc victim. Limit 1.
 
Life Tap 7.7 30.05sec

Stats details: life_tap

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.74 0.00 0.00 0.00 1.0423 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: life_tap

Static Values
  • id:1454
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.empowered_life_tap.enabled&!buff.empowered_life_tap.remains
Spelldata
  • id:1454
  • name:Life Tap
  • school:shadow
  • tooltip:
  • description:Restores {$s1=30}% of your maximum mana, at the cost of {$s2=10}% of your maximum health.
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Grimoire: Imp (service_imp) 3.7 91.86sec

Stats details: service_imp

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.68 0.00 0.00 0.00 0.9677 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: service_imp

Static Values
  • id:111859
  • school:shadow
  • resource:soul_shard
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:90.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:111859
  • name:Grimoire: Imp
  • school:shadow
  • tooltip:
  • description:Summons an Imp who attacks the target for {$108501s1=25} sec. Imps cast ranged Firebolts and cleanse a hostile magic effect from their master.
 
Soul Harvest 2.9 120.84sec

Stats details: soul_harvest

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.90 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: soul_harvest

Static Values
  • id:196098
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:196098
  • name:Soul Harvest
  • school:shadow
  • tooltip:Damage increased by {$s1=20}%.
  • description:Increases your damage and your pets' damage by {$s1=20}%. Lasts {$d=15 seconds}, increased by {$s2=2} sec for each target afflicted by your {$?s137043=false}[Agony][]{$?s137044=false}[Doom][]{$?s137046=false}[Immolate][], up to a maximum of {$s3=35} sec.
 
Summon Doomguard 1.0 0.00sec

Stats details: summon_doomguard

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 1.0790 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_doomguard

Static Values
  • id:18540
  • school:shadow
  • resource:soul_shard
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.grimoire_of_supremacy.enabled&active_enemies=1&artifact.lord_of_flames.rank=0
Spelldata
  • id:18540
  • name:Summon Doomguard
  • school:shadow
  • tooltip:
  • description:Summons a Doomguard for {$60478d=25 seconds} to assault the target with its Doom Bolts.
 
Summon Imp 1.0 0.00sec

Stats details: summon_imp

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_imp

Static Values
  • id:688
  • school:shadow
  • resource:soul_shard
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!talent.grimoire_of_supremacy.enabled&(!talent.grimoire_of_sacrifice.enabled|buff.demonic_power.down)
Spelldata
  • id:688
  • name:Summon Imp
  • school:shadow
  • tooltip:
  • description:Summons an Imp under your command that casts ranged Firebolts.$?s74434[ |cFFFFFFFFSoulburn:|r |cFF8282FFInstant cast.|r][]
 
Summon Infernal 1.0 0.00sec

Stats details: summon_infernal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.7566 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_infernal

Static Values
  • id:1122
  • school:shadow
  • resource:soul_shard
  • range:30.0
  • travel_speed:1.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.grimoire_of_supremacy.enabled&artifact.lord_of_flames.rank>0
Spelldata
  • id:1122
  • name:Summon Infernal
  • school:shadow
  • tooltip:
  • description:Summons an Infernal from the Twisting Nether, impacting for {$22703s1=0} Fire damage and stunning all enemy targets in the area for {$22703d=2 seconds}. The Infernal will serve you for {$111685d=25 seconds}, dealing strong area-of-effect damage.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Accelerando 20.1 0.0 15.4sec 15.4sec 78.49% 78.49% 1.4(1.4) 19.3

Buff details

  • buff initial source:Warlock_Destruction_T19M
  • cooldown name:buff_accelerando
  • max_stacks:5
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:734.41

Stack Uptimes

  • accelerando_1:29.74%
  • accelerando_2:24.61%
  • accelerando_3:14.71%
  • accelerando_4:6.53%
  • accelerando_5:2.90%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225719
  • name:Accelerando
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc225125=Your damaging spells have a chance to grant you {$225719s1=528} Haste for {$225719d=12 seconds}, stacking up to 5 times. Stacking does not refresh duration.}
  • max_stacks:5
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Berserking 2.1 0.0 180.7sec 180.7sec 6.87% 8.47% 0.0(0.0) 2.0

Buff details

  • buff initial source:Warlock_Destruction_T19M
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:10.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • berserking_1:6.87%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=15}%.
  • description:Increases your haste by {$s1=15}% for {$d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.55% 15.48% 0.0(0.0) 1.0

Buff details

  • buff initial source:Warlock_Destruction_T19M
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:13.55%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Conflagration of Chaos 24.3 0.0 12.3sec 12.3sec 49.11% 47.17% 0.0(0.0) 0.9

Buff details

  • buff initial source:Warlock_Destruction_T19M
  • cooldown name:buff_conflagration_of_chaos
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:50.00%
  • default_value:-0.00

Stack Uptimes

  • conflagration_of_chaos_1:49.11%

Trigger Attempt Success

  • trigger_pct:50.00%

Spelldata details

  • id:196546
  • name:Conflagration of Chaos
  • tooltip:Your {$?s17877=false}[Shadowburn][Conflagrate] will always critically strike. Critical strike chance will increase the critical strike damage of {$?s17877=false}[Shadowburn][Conflagrate].
  • description:{$@spelldesc219195={$?s17877=false}[Shadowburn][Conflagrate] has a chance to guarantee your next {$?s17877=false}[Shadowburn][Conflagrate] critically strikes, and to increase its damage by your critical strike chance.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Devil's Due 3.5 0.0 69.3sec 69.3sec 8.78% 10.32% 0.0(0.0) 3.3

Buff details

  • buff initial source:Warlock_Destruction_T19M
  • cooldown name:buff_devils_due
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.18

Stack Uptimes

  • devils_due_1:8.78%

Trigger Attempt Success

  • trigger_pct:99.90%

Spelldata details

  • id:225776
  • name:Devil's Due
  • tooltip:Cast speed slowed by {$s1=7}%.
  • description:{$@spelldesc225142=Your damaging spells have a chance to grant Nefarious Pact, increasing your casting speed by {$225774s1=17}% for {$225774d=12 seconds}. When Nefarious Pact expires, your casting speed is decreased by {$225776s1=7}% for {$225776d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Embrace Chaos 26.2 32.3 11.7sec 5.1sec 59.29% 66.65% 32.3(32.3) 25.6

Buff details

  • buff initial source:Warlock_Destruction_T19M
  • cooldown name:buff_embrace_chaos
  • max_stacks:1
  • duration:4.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • embrace_chaos_1:59.29%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:212019
  • name:Embrace Chaos
  • tooltip:Chaos Bolt has {$s1=40}% reduced cast time.
  • description:{$@spelldesc212018=Casting Chaos Bolt reduces the cast time of your next Chaos Bolt by {$212019s1=40}% for {$212019d=4 seconds}.}
  • max_stacks:0
  • duration:4.00
  • cooldown:0.00
  • default_chance:0.00%
Lord of Flames 1.0 0.0 0.0sec 0.0sec 97.88% 97.88% 0.0(0.0) 0.0

Buff details

  • buff initial source:Warlock_Destruction_T19M
  • cooldown name:buff_lord_of_flames
  • max_stacks:1
  • duration:600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • lord_of_flames_1:97.88%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:226802
  • name:Lord of Flames
  • tooltip:Recently activated Lord of Flames.
  • description:{$@spelldesc224103=Once every {$s2=10} minutes, {$?s152107=false}[your Infernal's Meteor Strike][Summon Infernal] will summon {$s3=3} additional Infernals to serve you for {$226804d=25 seconds}.}
  • max_stacks:0
  • duration:600.00
  • cooldown:0.00
  • default_chance:0.00%
Nefarious Pact 3.5 0.0 69.7sec 68.9sec 13.65% 15.15% 0.0(0.0) 3.4

Buff details

  • buff initial source:Warlock_Destruction_T19M
  • cooldown name:buff_nefarious_pact
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.44

Stack Uptimes

  • nefarious_pact_1:13.65%

Trigger Attempt Success

  • trigger_pct:99.90%

Spelldata details

  • id:225774
  • name:Nefarious Pact
  • tooltip:Cast speed increased by {$s1=17}%.
  • description:{$@spelldesc225142=Your damaging spells have a chance to grant Nefarious Pact, increasing your casting speed by {$225774s1=17}% for {$225774d=12 seconds}. When Nefarious Pact expires, your casting speed is decreased by {$225776s1=7}% for {$225776d=8 seconds}.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of Deadly Grace 1.0 0.0 0.0sec 0.0sec 10.16% 10.16% 0.0(0.0) 1.0

Buff details

  • buff initial source:Warlock_Destruction_T19M
  • cooldown name:buff_potion_of_deadly_grace
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_deadly_grace_1:10.16%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188027
  • name:Potion of Deadly Grace
  • tooltip:Your attacks have a chance to unleash a bolt of energy at your target.
  • description:Grants your attacks a chance to unleash a bolt of energy at your target. Staying away from enemies for the entire duration of the effect will extend the effect by an additional 5 seconds.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
Potion of Prolonged Power 1.0 0.0 0.0sec 0.0sec 19.64% 19.64% 0.0(0.0) 1.0

Buff details

  • buff initial source:Warlock_Destruction_T19M
  • cooldown name:buff_potion_of_prolonged_power
  • max_stacks:1
  • duration:60.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:all
  • amount:2500.00

Stack Uptimes

  • potion_of_prolonged_power_1:19.64%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:229206
  • name:Potion of Prolonged Power
  • tooltip:All stats increased by {$s1=2500}.
  • description:Drink to increase all stats by {$s1=2500} for {$d=60 seconds}.
  • max_stacks:0
  • duration:60.00
  • cooldown:1.00
  • default_chance:0.00%
Soul Harvest 2.9 0.0 120.8sec 120.8sec 17.77% 17.77% 0.0(0.0) 2.7

Buff details

  • buff initial source:Warlock_Destruction_T19M
  • cooldown name:buff_soul_harvest
  • max_stacks:1
  • duration:15.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • soul_harvest_1:17.77%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:196098
  • name:Soul Harvest
  • tooltip:Damage increased by {$s1=20}%.
  • description:Increases your damage and your pets' damage by {$s1=20}%. Lasts {$d=15 seconds}, increased by {$s2=2} sec for each target afflicted by your {$?s137043=false}[Agony][]{$?s137044=false}[Doom][]{$?s137046=false}[Immolate][], up to a maximum of {$s3=35} sec.
  • max_stacks:0
  • duration:15.00
  • cooldown:120.00
  • default_chance:0.00%
Constant Buffs
Well Fed (azshari_salad)

Buff details

  • buff initial source:Warlock_Destruction_T19M
  • cooldown name:buff_azshari_salad
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:375.00

Stack Uptimes

  • azshari_salad_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225603
  • name:Well Fed
  • tooltip:Haste increased by $w1.
  • description:Increases haste by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Defiled Augmentation

Buff details

  • buff initial source:Warlock_Destruction_T19M
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Whispered Pact

Buff details

  • buff initial source:Warlock_Destruction_T19M
  • cooldown name:buff_flask_of_the_whispered_pact
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:1300.00

Stack Uptimes

  • flask_of_the_whispered_pact_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188031
  • name:Flask of the Whispered Pact
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%

Procs

Count Interval
shadowy_tear 4.4 59.4sec
chaos_tear 4.4 58.8sec
chaos_portal 4.4 58.5sec
dimension_ripper 4.0 53.8sec

Resources

Resource Usage Type Count Total Average RPE APR
Warlock_Destruction_T19M
chaos_bolt Soul Shard 58.6 117.1 2.0 2.0 801444.2
havoc Mana 14.9 1310841.9 88000.0 88000.2 0.0
immolate Mana 20.0 1322197.1 66000.0 65999.6 53.0
incinerate Mana 80.9 5342067.6 66000.0 65998.7 7.4
service_imp Soul Shard 3.7 3.7 1.0 1.0 0.0
summon_doomguard Soul Shard 1.0 1.0 1.0 1.0 0.0
summon_infernal Soul Shard 1.0 1.0 1.0 1.0 0.0
pet - imp
firebolt Energy 109.2 4368.5 40.0 40.0 2863.0
pet - service_imp
firebolt Energy 49.3 1970.5 40.0 40.0 5847.6
pet - doomguard
doom_bolt Energy 11.0 386.2 35.0 35.0 6094.2
Resource Gains Type Count Total Average Overflow
life_tap Mana 7.74 2553598.92 (35.90%) 330000.00 0.00 0.00%
immolate Soul Shard 64.67 64.16 (52.82%) 0.99 0.52 0.80%
conflagrate Soul Shard 48.56 48.51 (39.94%) 1.00 0.05 0.11%
mp5_regen Mana 478.34 4559227.64 (64.10%) 9531.44 88959.60 1.91%
soulsnatcher Soul Shard 8.80 8.80 (7.25%) 1.00 0.00 0.00%
pet - imp
energy_regen Energy 1902.80 4202.08 (100.00%) 2.21 21.54 0.51%
pet - service_imp
energy_regen Energy 444.43 1352.04 (100.00%) 3.04 61.68 4.36%
pet - doomguard
energy_regen Energy 15.86 345.17 (100.00%) 21.77 43.11 11.10%
Resource RPS-Gain RPS-Loss
Health 0.00 7946.01
Mana 23621.42 26484.99
Soul Shard 0.40 0.41
Combat End Resource Mean Min Max
Mana 239205.14 5009.47 503517.49
Soul Shard 1.63 0.00 5.00

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 1.4%

Statistics & Data Analysis

Fight Length
Sample Data Warlock_Destruction_T19M Fight Length
Count 9999
Mean 301.12
Minimum 221.26
Maximum 379.15
Spread ( max - min ) 157.89
Range [ ( max - min ) / 2 * 100% ] 26.22%
DPS
Sample Data Warlock_Destruction_T19M Damage Per Second
Count 9999
Mean 970635.04
Minimum 850205.68
Maximum 1130447.63
Spread ( max - min ) 280241.95
Range [ ( max - min ) / 2 * 100% ] 14.44%
Priority Target DPS
Sample Data Warlock_Destruction_T19M Priority Target Damage Per Second
Count 9999
Mean 568907.32
Minimum 497542.98
Maximum 652739.21
Spread ( max - min ) 155196.24
Range [ ( max - min ) / 2 * 100% ] 13.64%
DPS(e)
Sample Data Warlock_Destruction_T19M Damage Per Second (Effective)
Count 9999
Mean 970635.04
Minimum 850205.68
Maximum 1130447.63
Spread ( max - min ) 280241.95
Range [ ( max - min ) / 2 * 100% ] 14.44%
Damage
Sample Data Warlock_Destruction_T19M Damage
Count 9999
Mean 239273044.80
Minimum 169137907.21
Maximum 313350535.72
Spread ( max - min ) 144212628.51
Range [ ( max - min ) / 2 * 100% ] 30.14%
DTPS
Sample Data Warlock_Destruction_T19M Damage Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Warlock_Destruction_T19M Healing Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS(e)
Sample Data Warlock_Destruction_T19M Healing Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Warlock_Destruction_T19M Heal
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Warlock_Destruction_T19M Healing Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Warlock_Destruction_T19M Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
ETMI
Sample Data Warlock_Destruction_T19MTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data Warlock_Destruction_T19M Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=whispered_pact
1 0.00 food,type=azshari_salad
2 0.00 summon_pet,if=!talent.grimoire_of_supremacy.enabled&(!talent.grimoire_of_sacrifice.enabled|buff.demonic_power.down)
3 0.00 summon_infernal,if=talent.grimoire_of_supremacy.enabled&artifact.lord_of_flames.rank>0
4 0.00 summon_infernal,if=talent.grimoire_of_supremacy.enabled&active_enemies>1
5 0.00 summon_doomguard,if=talent.grimoire_of_supremacy.enabled&active_enemies=1&artifact.lord_of_flames.rank=0
6 0.00 augmentation,type=defiled
7 0.00 snapshot_stats
8 0.00 grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
9 0.00 life_tap,if=talent.empowered_life_tap.enabled&!buff.empowered_life_tap.remains
A 0.00 potion,name=prolonged_power
B 0.00 chaos_bolt
Default action list Executed every time the actor is available.
# count action,conditions
C 14.90 havoc,target=2,if=active_enemies>1&(active_enemies<4|talent.wreak_havoc.enabled&active_enemies<6)&!debuff.havoc.remains
D 1.00 dimensional_rift,if=charges=3
E 10.32 immolate,if=remains<=tick_time
F 0.66 immolate,cycle_targets=1,if=active_enemies>1&remains<=tick_time&(!talent.roaring_blaze.enabled|(!debuff.roaring_blaze.remains&action.conflagrate.charges<2))
G 9.09 immolate,if=talent.roaring_blaze.enabled&remains<=duration&!debuff.roaring_blaze.remains&target.time_to_die>10&(action.conflagrate.charges=2+set_bonus.tier19_4pc|(action.conflagrate.charges>=1+set_bonus.tier19_4pc&action.conflagrate.recharge_time<cast_time+gcd)|target.time_to_die<24)
H 2.08 berserking
0.00 blood_fury
0.00 arcane_torrent
I 1.00 potion,name=deadly_grace,if=(buff.soul_harvest.remains|trinket.proc.any.react|target.time_to_die<=45)
0.00 shadowburn,if=buff.conflagration_of_chaos.remains<=action.chaos_bolt.cast_time
0.00 shadowburn,if=(charges=1&recharge_time<action.chaos_bolt.cast_time|charges=2)&soul_shard<5
J 13.87 conflagrate,if=talent.roaring_blaze.enabled&(charges=2+set_bonus.tier19_4pc|(charges>=1+set_bonus.tier19_4pc&recharge_time<gcd)|target.time_to_die<24)
K 34.70 conflagrate,if=talent.roaring_blaze.enabled&debuff.roaring_blaze.stack>0&dot.immolate.remains>dot.immolate.duration*0.3&(active_enemies=1|soul_shard<3)&soul_shard<5
0.00 conflagrate,if=!talent.roaring_blaze.enabled&!buff.backdraft.remains&buff.conflagration_of_chaos.remains<=action.chaos_bolt.cast_time
0.00 conflagrate,if=!talent.roaring_blaze.enabled&!buff.backdraft.remains&(charges=1&recharge_time<action.chaos_bolt.cast_time|charges=2)&soul_shard<5
0.00 life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<=gcd
0.00 dimensional_rift,if=equipped.144369&!buff.lessons_of_spacetime.remains&((!talent.grimoire_of_supremacy.enabled&!cooldown.summon_doomguard.remains)|(talent.grimoire_of_service.enabled&!cooldown.service_pet.remains)|(talent.soul_harvest.enabled&!cooldown.soul_harvest.remains))
L 3.68 service_pet
M 1.00 summon_infernal,if=artifact.lord_of_flames.rank>0&!buff.lord_of_flames.remains
N 1.00 summon_doomguard,if=!talent.grimoire_of_supremacy.enabled&spell_targets.infernal_awakening<=2&(target.time_to_die>180|target.health.pct<=20|target.time_to_die<30)
0.00 summon_infernal,if=!talent.grimoire_of_supremacy.enabled&spell_targets.infernal_awakening>2
0.00 summon_doomguard,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal=1&artifact.lord_of_flames.rank>0&buff.lord_of_flames.remains&!pet.doomguard.active
0.00 summon_doomguard,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal=1&equipped.132379&!cooldown.sindorei_spite_icd.remains
0.00 summon_infernal,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal>1&equipped.132379&!cooldown.sindorei_spite_icd.remains
O 2.90 soul_harvest
0.00 channel_demonfire,if=dot.immolate.remains>cast_time
0.00 havoc,if=active_enemies=1&talent.wreak_havoc.enabled&equipped.132375&!debuff.havoc.remains
0.00 rain_of_fire,if=active_enemies>=3&cooldown.havoc.remains<=12&!talent.wreak_havoc.enabled
0.00 rain_of_fire,if=active_enemies>=6&talent.wreak_havoc.enabled
P 12.18 dimensional_rift,if=!equipped.144369|charges>1|((!talent.grimoire_of_service.enabled|recharge_time<cooldown.service_pet.remains)&(!talent.soul_harvest.enabled|recharge_time<cooldown.soul_harvest.remains)&(!talent.grimoire_of_supremacy.enabled|recharge_time<cooldown.summon_doomguard.remains))
0.00 life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<duration*0.3
0.00 cataclysm
Q 57.89 chaos_bolt,if=(cooldown.havoc.remains>12&cooldown.havoc.remains|active_enemies<3|talent.wreak_havoc.enabled&active_enemies<6)
0.00 shadowburn
0.00 conflagrate,if=!talent.roaring_blaze.enabled&!buff.backdraft.remains
0.00 immolate,if=!talent.roaring_blaze.enabled&remains<=duration*0.3
R 81.28 incinerate
S 7.74 life_tap

Sample Sequence

0126ABCDEGHJKLMKOPPQKQRKQRRRKQCRRRRERRRRQGJKKQRRKQCRQKPQRRRRRQERRSRRRCGJQKKQKQRRRQRKQQRSCRERRQPRRGJKLKQCKQQRQKQRRSREQRCQROIRRGJKQKPQKQRRCKQRSQERRRRRRQGJCQKQKKFQQQKPRHQRRSCELRRRRGJKQKQRKRSRCQRKQRRRRESRRQPRRCGJKNKQQKQRRQKOQRCRRSERRQRRGJKQKCPQKQQRJLPRRJQEGRQSCJQRRRRQJ

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask Warlock_Destruction_T19M 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 1 food Warlock_Destruction_T19M 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 2 summon_imp Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 6 augmentation Warlock_Destruction_T19M 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat A potion Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard potion_of_prolonged_power
0:00.000 precombat B chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard embrace_chaos, accelerando, potion_of_prolonged_power
0:00.000 default C havoc enemy2 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard embrace_chaos, accelerando, potion_of_prolonged_power
0:01.139 default D dimensional_rift Fluffy_Pillow 1033522.3/1100000: 94% mana | 1.0/5: 20% soul_shard bloodlust, embrace_chaos, accelerando, potion_of_prolonged_power
0:02.017 default E immolate Fluffy_Pillow 1050112.9/1100000: 95% mana | 1.0/5: 20% soul_shard bloodlust, embrace_chaos, accelerando, potion_of_prolonged_power
0:02.894 default G immolate Fluffy_Pillow 1000684.5/1100000: 91% mana | 1.0/5: 20% soul_shard bloodlust, embrace_chaos, accelerando, potion_of_prolonged_power
0:03.774 default H berserking Fluffy_Pillow 951312.9/1100000: 86% mana | 1.0/5: 20% soul_shard bloodlust, embrace_chaos, accelerando, potion_of_prolonged_power
0:03.774 default J conflagrate Fluffy_Pillow 951312.9/1100000: 86% mana | 1.0/5: 20% soul_shard bloodlust, berserking, embrace_chaos, accelerando, potion_of_prolonged_power
0:04.536 default K conflagrate Fluffy_Pillow 967871.3/1100000: 88% mana | 2.0/5: 40% soul_shard bloodlust, berserking, accelerando, potion_of_prolonged_power
0:05.300 default L service_imp Fluffy_Pillow 984473.2/1100000: 89% mana | 4.0/5: 80% soul_shard bloodlust, berserking, conflagration_of_chaos, accelerando, potion_of_prolonged_power
0:06.064 default M summon_infernal Fluffy_Pillow 1001075.0/1100000: 91% mana | 3.0/5: 60% soul_shard bloodlust, berserking, conflagration_of_chaos, accelerando, potion_of_prolonged_power
0:06.827 default K conflagrate Fluffy_Pillow 1017655.2/1100000: 93% mana | 2.0/5: 40% soul_shard bloodlust, berserking, lord_of_flames, conflagration_of_chaos, accelerando, potion_of_prolonged_power
0:07.588 default O soul_harvest Fluffy_Pillow 1034191.9/1100000: 94% mana | 3.0/5: 60% soul_shard bloodlust, berserking, lord_of_flames, conflagration_of_chaos, accelerando, potion_of_prolonged_power
0:07.588 default P dimensional_rift Fluffy_Pillow 1034191.9/1100000: 94% mana | 3.0/5: 60% soul_shard bloodlust, berserking, soul_harvest, lord_of_flames, conflagration_of_chaos, accelerando, potion_of_prolonged_power
0:08.352 default P dimensional_rift Fluffy_Pillow 1050793.7/1100000: 96% mana | 3.0/5: 60% soul_shard bloodlust, berserking, soul_harvest, lord_of_flames, conflagration_of_chaos, accelerando, potion_of_prolonged_power
0:09.114 default Q chaos_bolt Fluffy_Pillow 1067352.1/1100000: 97% mana | 3.0/5: 60% soul_shard bloodlust, berserking, soul_harvest, lord_of_flames, conflagration_of_chaos, accelerando, potion_of_prolonged_power
0:10.638 default K conflagrate Fluffy_Pillow 1100000.0/1100000: 100% mana | 2.0/5: 40% soul_shard bloodlust, berserking, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2), potion_of_prolonged_power
0:11.394 default Q chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard bloodlust, berserking, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2), potion_of_prolonged_power
0:12.295 default R incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard bloodlust, berserking, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando, potion_of_prolonged_power
0:13.213 default K conflagrate Fluffy_Pillow 1034152.1/1100000: 94% mana | 1.0/5: 20% soul_shard bloodlust, berserking, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando, potion_of_prolonged_power
0:13.977 default Q chaos_bolt Fluffy_Pillow 1050178.6/1100000: 95% mana | 2.0/5: 40% soul_shard bloodlust, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando, potion_of_prolonged_power
0:15.028 default R incinerate Fluffy_Pillow 1070038.1/1100000: 97% mana | 0.0/5: 0% soul_shard bloodlust, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando, potion_of_prolonged_power
0:16.081 default R incinerate Fluffy_Pillow 1023935.4/1100000: 93% mana | 1.0/5: 20% soul_shard bloodlust, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando, potion_of_prolonged_power
0:17.133 default R incinerate Fluffy_Pillow 977813.8/1100000: 89% mana | 1.0/5: 20% soul_shard bloodlust, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando, potion_of_prolonged_power
0:18.184 default K conflagrate Fluffy_Pillow 931673.4/1100000: 85% mana | 1.0/5: 20% soul_shard bloodlust, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando, potion_of_prolonged_power
0:19.061 default Q chaos_bolt Fluffy_Pillow 948245.0/1100000: 86% mana | 2.0/5: 40% soul_shard bloodlust, soul_harvest, lord_of_flames, accelerando, potion_of_prolonged_power
0:20.812 default C havoc enemy2 981331.6/1100000: 89% mana | 0.0/5: 0% soul_shard bloodlust, soul_harvest, lord_of_flames, embrace_chaos, accelerando, potion_of_prolonged_power
0:21.690 default R incinerate Fluffy_Pillow 909922.1/1100000: 83% mana | 0.0/5: 0% soul_shard bloodlust, soul_harvest, lord_of_flames, embrace_chaos, accelerando, potion_of_prolonged_power
0:22.739 default R incinerate Fluffy_Pillow 863888.2/1100000: 79% mana | 0.0/5: 0% soul_shard bloodlust, soul_harvest, lord_of_flames, embrace_chaos, accelerando(2), potion_of_prolonged_power
0:23.773 default R incinerate Fluffy_Pillow 817716.3/1100000: 74% mana | 0.0/5: 0% soul_shard bloodlust, soul_harvest, lord_of_flames, embrace_chaos, accelerando(2), potion_of_prolonged_power
0:24.809 default R incinerate Fluffy_Pillow 771243.8/1100000: 70% mana | 0.0/5: 0% soul_shard bloodlust, soul_harvest, lord_of_flames, potion_of_prolonged_power
0:25.876 default E immolate Fluffy_Pillow 725107.0/1100000: 66% mana | 1.0/5: 20% soul_shard bloodlust, soul_harvest, lord_of_flames, potion_of_prolonged_power
0:26.766 default R incinerate Fluffy_Pillow 675675.2/1100000: 61% mana | 1.0/5: 20% soul_shard bloodlust, lord_of_flames, potion_of_prolonged_power
0:27.834 default R incinerate Fluffy_Pillow 629557.0/1100000: 57% mana | 1.0/5: 20% soul_shard bloodlust, lord_of_flames, potion_of_prolonged_power
0:28.899 default R incinerate Fluffy_Pillow 583383.6/1100000: 53% mana | 1.0/5: 20% soul_shard bloodlust, lord_of_flames, accelerando, potion_of_prolonged_power
0:29.951 default R incinerate Fluffy_Pillow 537262.0/1100000: 49% mana | 1.0/5: 20% soul_shard bloodlust, lord_of_flames, accelerando, potion_of_prolonged_power
0:31.003 default Q chaos_bolt Fluffy_Pillow 491140.4/1100000: 45% mana | 2.0/5: 40% soul_shard bloodlust, lord_of_flames, accelerando, potion_of_prolonged_power
0:32.752 default G immolate Fluffy_Pillow 524190.0/1100000: 48% mana | 0.0/5: 0% soul_shard bloodlust, lord_of_flames, embrace_chaos, accelerando(2), potion_of_prolonged_power
0:33.618 default J conflagrate Fluffy_Pillow 474796.5/1100000: 43% mana | 0.0/5: 0% soul_shard bloodlust, lord_of_flames, embrace_chaos, accelerando(2), potion_of_prolonged_power
0:34.482 default K conflagrate Fluffy_Pillow 491364.7/1100000: 45% mana | 1.0/5: 20% soul_shard bloodlust, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2), potion_of_prolonged_power
0:35.347 default K conflagrate Fluffy_Pillow 507952.0/1100000: 46% mana | 2.0/5: 40% soul_shard bloodlust, lord_of_flames, embrace_chaos, accelerando(2), potion_of_prolonged_power
0:36.211 default Q chaos_bolt Fluffy_Pillow 524520.2/1100000: 48% mana | 3.0/5: 60% soul_shard bloodlust, lord_of_flames, embrace_chaos, accelerando(2), potion_of_prolonged_power
0:37.245 default R incinerate Fluffy_Pillow 544348.3/1100000: 49% mana | 1.0/5: 20% soul_shard bloodlust, lord_of_flames, embrace_chaos, accelerando(2), potion_of_prolonged_power
0:38.282 default R incinerate Fluffy_Pillow 498233.9/1100000: 45% mana | 1.0/5: 20% soul_shard bloodlust, lord_of_flames, embrace_chaos, accelerando(2), potion_of_prolonged_power
0:39.317 default K conflagrate Fluffy_Pillow 452081.2/1100000: 41% mana | 1.0/5: 20% soul_shard bloodlust, lord_of_flames, embrace_chaos, accelerando(2), potion_of_prolonged_power
0:40.180 default Q chaos_bolt Fluffy_Pillow 468630.2/1100000: 43% mana | 3.0/5: 60% soul_shard bloodlust, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2), potion_of_prolonged_power
0:41.218 default C havoc enemy2 486976.1/1100000: 44% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, potion_of_prolonged_power
0:42.376 default R incinerate Fluffy_Pillow 415558.6/1100000: 38% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, potion_of_prolonged_power
0:43.763 default Q chaos_bolt Fluffy_Pillow 369507.0/1100000: 34% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando, potion_of_prolonged_power
0:45.131 default K conflagrate Fluffy_Pillow 389392.5/1100000: 35% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2), potion_of_prolonged_power
0:46.254 default P dimensional_rift Fluffy_Pillow 405957.7/1100000: 37% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2), potion_of_prolonged_power
0:47.377 default Q chaos_bolt Fluffy_Pillow 422764.7/1100000: 38% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3), potion_of_prolonged_power
0:48.703 default R incinerate Fluffy_Pillow 442789.8/1100000: 40% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(4), potion_of_prolonged_power
0:50.011 default R incinerate Fluffy_Pillow 396647.6/1100000: 36% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(4), potion_of_prolonged_power
0:51.319 default R incinerate Fluffy_Pillow 350505.3/1100000: 32% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(4), potion_of_prolonged_power
0:52.228 default R incinerate Fluffy_Pillow 298305.6/1100000: 27% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(4), potion_of_prolonged_power
0:53.136 default R incinerate Fluffy_Pillow 246090.6/1100000: 22% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, nefarious_pact, accelerando(4), potion_of_prolonged_power
0:54.044 default Q chaos_bolt Fluffy_Pillow 193938.7/1100000: 18% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, nefarious_pact, accelerando(5), potion_of_prolonged_power
0:55.534 default E immolate Fluffy_Pillow 216694.0/1100000: 20% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, potion_of_prolonged_power
0:56.336 default R incinerate Fluffy_Pillow 162234.4/1100000: 15% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando, potion_of_prolonged_power
0:57.284 default R incinerate Fluffy_Pillow 110013.8/1100000: 10% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando, potion_of_prolonged_power
0:58.230 default S life_tap Fluffy_Pillow 57764.1/1100000: 5% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando
0:59.019 default R incinerate Fluffy_Pillow 399232.4/1100000: 36% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando
0:59.968 default R incinerate Fluffy_Pillow 347026.4/1100000: 32% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, nefarious_pact, accelerando
1:00.914 default R incinerate Fluffy_Pillow 294776.8/1100000: 27% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, nefarious_pact, accelerando
1:01.861 default C havoc enemy2 242541.6/1100000: 22% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, nefarious_pact, accelerando
1:02.651 default G immolate Fluffy_Pillow 166024.5/1100000: 15% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, devils_due, accelerando
1:03.992 default J conflagrate Fluffy_Pillow 119516.3/1100000: 11% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, devils_due, accelerando
1:05.332 default Q chaos_bolt Fluffy_Pillow 138993.5/1100000: 13% mana | 3.0/5: 60% soul_shard lord_of_flames, devils_due, accelerando
1:08.012 default K conflagrate Fluffy_Pillow 178445.6/1100000: 16% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, devils_due, accelerando(2)
1:09.335 default K conflagrate Fluffy_Pillow 197624.7/1100000: 18% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due, accelerando
1:10.678 default Q chaos_bolt Fluffy_Pillow 217145.6/1100000: 20% mana | 3.0/5: 60% soul_shard lord_of_flames, embrace_chaos, accelerando
1:12.044 default K conflagrate Fluffy_Pillow 237000.7/1100000: 22% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, nefarious_pact, accelerando
1:12.834 default Q chaos_bolt Fluffy_Pillow 248483.6/1100000: 23% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando
1:13.782 default R incinerate Fluffy_Pillow 262462.2/1100000: 24% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(2)
1:14.717 default R incinerate Fluffy_Pillow 210254.2/1100000: 19% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(2)
1:15.653 default R incinerate Fluffy_Pillow 158061.0/1100000: 14% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(2)
1:16.588 default Q chaos_bolt Fluffy_Pillow 105853.1/1100000: 10% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(2)
1:17.523 default R incinerate Fluffy_Pillow 119646.2/1100000: 11% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(3)
1:18.444 default K conflagrate Fluffy_Pillow 67430.1/1100000: 6% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(3)
1:19.210 default Q chaos_bolt Fluffy_Pillow 78894.1/1100000: 7% mana | 4.0/5: 80% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(3)
1:20.130 default Q chaos_bolt Fluffy_Pillow 92663.0/1100000: 8% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(3)
1:21.050 default R incinerate Fluffy_Pillow 105998.3/1100000: 10% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact
1:22.010 default S life_tap Fluffy_Pillow 53745.4/1100000: 5% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact
1:22.813 default C havoc enemy2 395244.3/1100000: 36% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact
1:23.616 default R incinerate Fluffy_Pillow 318743.2/1100000: 29% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due
1:25.250 default E immolate Fluffy_Pillow 276459.4/1100000: 25% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, devils_due, accelerando
1:26.593 default R incinerate Fluffy_Pillow 229980.2/1100000: 21% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, devils_due, accelerando
1:28.202 default R incinerate Fluffy_Pillow 187367.5/1100000: 17% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, devils_due, accelerando
1:29.810 default Q chaos_bolt Fluffy_Pillow 144740.2/1100000: 13% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, devils_due, accelerando
1:32.488 default P dimensional_rift Fluffy_Pillow 183665.6/1100000: 17% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
1:33.627 default R incinerate Fluffy_Pillow 200221.2/1100000: 18% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
1:34.993 default R incinerate Fluffy_Pillow 154170.8/1100000: 14% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
1:36.339 default G immolate Fluffy_Pillow 107783.7/1100000: 10% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
1:37.479 default J conflagrate Fluffy_Pillow 58404.3/1100000: 5% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, accelerando(2)
1:38.599 default K conflagrate Fluffy_Pillow 74925.3/1100000: 7% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, accelerando(2)
1:39.721 default L service_imp Fluffy_Pillow 91475.8/1100000: 8% mana | 3.0/5: 60% soul_shard lord_of_flames, accelerando(2)
1:40.843 default K conflagrate Fluffy_Pillow 108026.2/1100000: 10% mana | 2.0/5: 40% soul_shard lord_of_flames, accelerando(2)
1:41.966 default Q chaos_bolt Fluffy_Pillow 124591.4/1100000: 11% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, accelerando(2)
1:44.210 default C havoc enemy2 157830.4/1100000: 14% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
1:45.315 default K conflagrate Fluffy_Pillow 86368.0/1100000: 8% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
1:46.421 default Q chaos_bolt Fluffy_Pillow 102920.5/1100000: 9% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
1:47.748 default Q chaos_bolt Fluffy_Pillow 122781.7/1100000: 11% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(4)
1:49.057 default R incinerate Fluffy_Pillow 142032.4/1100000: 13% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
1:50.445 default Q chaos_bolt Fluffy_Pillow 95908.5/1100000: 9% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
1:51.832 default K conflagrate Fluffy_Pillow 115770.3/1100000: 11% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
1:53.194 default Q chaos_bolt Fluffy_Pillow 135274.0/1100000: 12% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
1:54.581 default R incinerate Fluffy_Pillow 155136.9/1100000: 14% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
1:55.949 default R incinerate Fluffy_Pillow 109021.1/1100000: 10% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
1:57.317 default S life_tap Fluffy_Pillow 62905.3/1100000: 6% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
1:58.456 default R incinerate Fluffy_Pillow 409461.0/1100000: 37% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
1:59.824 default E immolate Fluffy_Pillow 363451.5/1100000: 33% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, accelerando(2)
2:00.946 default Q chaos_bolt Fluffy_Pillow 314001.9/1100000: 29% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, accelerando(2)
2:03.188 default R incinerate Fluffy_Pillow 347073.4/1100000: 32% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
2:04.533 default C havoc enemy2 300913.3/1100000: 27% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
2:05.655 default Q chaos_bolt Fluffy_Pillow 229463.7/1100000: 21% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
2:07.003 default R incinerate Fluffy_Pillow 249163.9/1100000: 23% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
2:08.389 default O soul_harvest Fluffy_Pillow 203012.2/1100000: 18% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
2:08.389 default I potion Fluffy_Pillow 203012.2/1100000: 18% mana | 0.0/5: 0% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
2:08.389 default R incinerate Fluffy_Pillow 203012.2/1100000: 18% mana | 0.0/5: 0% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando, potion_of_deadly_grace
2:09.756 default R incinerate Fluffy_Pillow 156881.9/1100000: 14% mana | 0.0/5: 0% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando, potion_of_deadly_grace
2:11.123 default G immolate Fluffy_Pillow 110751.6/1100000: 10% mana | 0.0/5: 0% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, accelerando, potion_of_deadly_grace
2:12.264 default J conflagrate Fluffy_Pillow 61336.3/1100000: 6% mana | 0.0/5: 0% soul_shard soul_harvest, lord_of_flames, accelerando, potion_of_deadly_grace
2:13.404 default K conflagrate Fluffy_Pillow 77906.5/1100000: 7% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, accelerando, potion_of_deadly_grace
2:14.545 default Q chaos_bolt Fluffy_Pillow 94491.2/1100000: 9% mana | 3.0/5: 60% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, accelerando, potion_of_deadly_grace
2:16.819 default K conflagrate Fluffy_Pillow 127544.4/1100000: 12% mana | 2.0/5: 40% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando, potion_of_deadly_grace
2:17.957 default P dimensional_rift Fluffy_Pillow 144085.5/1100000: 13% mana | 3.0/5: 60% soul_shard soul_harvest, lord_of_flames, embrace_chaos, accelerando, potion_of_deadly_grace
2:19.096 default Q chaos_bolt Fluffy_Pillow 160653.9/1100000: 15% mana | 3.0/5: 60% soul_shard soul_harvest, lord_of_flames, embrace_chaos, accelerando(2), potion_of_deadly_grace
2:20.443 default K conflagrate Fluffy_Pillow 180498.3/1100000: 16% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, embrace_chaos, potion_of_deadly_grace
2:21.599 default Q chaos_bolt Fluffy_Pillow 197052.1/1100000: 18% mana | 2.0/5: 40% soul_shard soul_harvest, lord_of_flames, embrace_chaos, potion_of_deadly_grace
2:22.985 default R incinerate Fluffy_Pillow 216900.4/1100000: 20% mana | 0.0/5: 0% soul_shard soul_harvest, lord_of_flames, embrace_chaos, accelerando, potion_of_deadly_grace
2:24.352 default R incinerate Fluffy_Pillow 170771.2/1100000: 16% mana | 0.0/5: 0% soul_shard soul_harvest, lord_of_flames, embrace_chaos, accelerando(2), potion_of_deadly_grace
2:25.697 default C havoc enemy2 124611.7/1100000: 11% mana | 0.0/5: 0% soul_shard soul_harvest, lord_of_flames, embrace_chaos, accelerando(3), potion_of_deadly_grace
2:26.802 default K conflagrate Fluffy_Pillow 53149.3/1100000: 5% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, embrace_chaos, accelerando(3), potion_of_deadly_grace
2:27.909 default Q chaos_bolt Fluffy_Pillow 69955.6/1100000: 6% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, accelerando(4), potion_of_deadly_grace
2:30.087 default R incinerate Fluffy_Pillow 103021.4/1100000: 9% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(4), potion_of_deadly_grace
2:31.397 default S life_tap Fluffy_Pillow 56909.5/1100000: 5% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(4), potion_of_deadly_grace
2:32.489 default Q chaos_bolt Fluffy_Pillow 403507.6/1100000: 37% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(5), potion_of_deadly_grace
2:33.779 default E immolate Fluffy_Pillow 423369.8/1100000: 38% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(5), potion_of_deadly_grace
2:34.856 default R incinerate Fluffy_Pillow 373952.5/1100000: 34% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(5), potion_of_deadly_grace
2:36.147 default R incinerate Fluffy_Pillow 326574.2/1100000: 30% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, potion_of_deadly_grace
2:37.533 default R incinerate Fluffy_Pillow 280421.6/1100000: 25% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, potion_of_deadly_grace
2:38.920 default R incinerate Fluffy_Pillow 234283.4/1100000: 21% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos
2:40.308 default R incinerate Fluffy_Pillow 188168.5/1100000: 17% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, accelerando
2:41.674 default R incinerate Fluffy_Pillow 142024.5/1100000: 13% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, accelerando(2)
2:43.022 default Q chaos_bolt Fluffy_Pillow 95910.0/1100000: 9% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, accelerando(3)
2:45.232 default G immolate Fluffy_Pillow 128985.2/1100000: 12% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
2:46.338 default J conflagrate Fluffy_Pillow 79537.7/1100000: 7% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
2:47.445 default C havoc enemy2 96105.3/1100000: 9% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
2:48.553 default Q chaos_bolt Fluffy_Pillow 24687.8/1100000: 2% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
2:49.880 default K conflagrate Fluffy_Pillow 44549.0/1100000: 4% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(4)
2:50.970 default Q chaos_bolt Fluffy_Pillow 61097.1/1100000: 6% mana | 3.0/5: 60% soul_shard lord_of_flames, embrace_chaos, accelerando(4)
2:52.277 default K conflagrate Fluffy_Pillow 80930.2/1100000: 7% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos
2:53.432 default K conflagrate Fluffy_Pillow 97469.7/1100000: 9% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos
2:54.588 default F immolate enemy2 114023.6/1100000: 10% mana | 5.0/5: 100% soul_shard lord_of_flames, embrace_chaos
2:55.744 default Q chaos_bolt Fluffy_Pillow 64577.4/1100000: 6% mana | 5.0/5: 100% soul_shard lord_of_flames, embrace_chaos
2:57.131 default Q chaos_bolt Fluffy_Pillow 84440.3/1100000: 8% mana | 3.0/5: 60% soul_shard lord_of_flames, embrace_chaos, accelerando
2:58.497 default Q chaos_bolt Fluffy_Pillow 104295.4/1100000: 9% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando
2:59.864 default K conflagrate Fluffy_Pillow 124165.1/1100000: 11% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos, accelerando
3:01.004 default P dimensional_rift Fluffy_Pillow 140735.3/1100000: 13% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
3:02.279 default R incinerate Fluffy_Pillow 159267.7/1100000: 14% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
3:03.645 default H berserking Fluffy_Pillow 113122.9/1100000: 10% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
3:03.774 default Q chaos_bolt Fluffy_Pillow 114997.9/1100000: 10% mana | 2.0/5: 40% soul_shard berserking, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
3:04.963 default R incinerate Fluffy_Pillow 134872.7/1100000: 12% mana | 0.0/5: 0% soul_shard berserking, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
3:06.150 default R incinerate Fluffy_Pillow 88714.1/1100000: 8% mana | 0.0/5: 0% soul_shard berserking, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
3:07.336 default S life_tap Fluffy_Pillow 42538.7/1100000: 4% mana | 1.0/5: 20% soul_shard berserking, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
3:08.327 default C havoc enemy2 389103.8/1100000: 35% mana | 1.0/5: 20% soul_shard berserking, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
3:09.318 default E immolate Fluffy_Pillow 317819.5/1100000: 29% mana | 1.0/5: 20% soul_shard berserking, lord_of_flames, conflagration_of_chaos
3:10.323 default L service_imp Fluffy_Pillow 268369.7/1100000: 24% mana | 1.0/5: 20% soul_shard berserking, lord_of_flames, conflagration_of_chaos
3:11.330 default R incinerate Fluffy_Pillow 284953.0/1100000: 26% mana | 0.0/5: 0% soul_shard berserking, lord_of_flames, conflagration_of_chaos
3:12.536 default R incinerate Fluffy_Pillow 238813.3/1100000: 22% mana | 0.0/5: 0% soul_shard berserking, lord_of_flames, conflagration_of_chaos
3:13.743 default R incinerate Fluffy_Pillow 192690.1/1100000: 18% mana | 0.0/5: 0% soul_shard berserking, lord_of_flames, conflagration_of_chaos
3:14.950 default R incinerate Fluffy_Pillow 144040.9/1100000: 13% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos
3:16.336 default G immolate Fluffy_Pillow 97888.3/1100000: 9% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos
3:17.494 default J conflagrate Fluffy_Pillow 48470.8/1100000: 4% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos
3:18.651 default K conflagrate Fluffy_Pillow 65039.0/1100000: 6% mana | 2.0/5: 40% soul_shard lord_of_flames
3:19.807 default Q chaos_bolt Fluffy_Pillow 81592.8/1100000: 7% mana | 3.0/5: 60% soul_shard lord_of_flames
3:22.115 default K conflagrate Fluffy_Pillow 114832.3/1100000: 10% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando
3:23.253 default Q chaos_bolt Fluffy_Pillow 131373.4/1100000: 12% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando
3:24.620 default R incinerate Fluffy_Pillow 151243.1/1100000: 14% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos, nefarious_pact, accelerando
3:25.568 default K conflagrate Fluffy_Pillow 99022.5/1100000: 9% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos, nefarious_pact, accelerando
3:26.358 default R incinerate Fluffy_Pillow 110505.4/1100000: 10% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando
3:27.306 default S life_tap Fluffy_Pillow 58285.9/1100000: 5% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(2)
3:28.085 default R incinerate Fluffy_Pillow 399776.8/1100000: 36% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(2)
3:29.020 default C havoc enemy2 347587.6/1100000: 32% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, nefarious_pact, accelerando(3)
3:29.787 default Q chaos_bolt Fluffy_Pillow 271066.6/1100000: 25% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, nefarious_pact, accelerando(3)
3:31.320 default R incinerate Fluffy_Pillow 294009.8/1100000: 27% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(3)
3:32.240 default K conflagrate Fluffy_Pillow 241778.6/1100000: 22% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(3)
3:33.008 default Q chaos_bolt Fluffy_Pillow 253272.6/1100000: 23% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, nefarious_pact, accelerando(3)
3:33.927 default R incinerate Fluffy_Pillow 266580.7/1100000: 24% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos, nefarious_pact
3:34.888 default R incinerate Fluffy_Pillow 214342.1/1100000: 19% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos, nefarious_pact
3:35.850 default R incinerate Fluffy_Pillow 162117.9/1100000: 15% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos, nefarious_pact
3:36.812 default R incinerate Fluffy_Pillow 109893.7/1100000: 10% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos, devils_due
3:38.447 default E immolate Fluffy_Pillow 67308.1/1100000: 6% mana | 0.0/5: 0% soul_shard lord_of_flames, devils_due, accelerando
3:39.788 default S life_tap Fluffy_Pillow 20800.7/1100000: 2% mana | 1.0/5: 20% soul_shard lord_of_flames, devils_due, accelerando(2)
3:41.112 default R incinerate Fluffy_Pillow 370330.9/1100000: 34% mana | 1.0/5: 20% soul_shard lord_of_flames, devils_due, accelerando(2)
3:42.699 default R incinerate Fluffy_Pillow 327740.5/1100000: 30% mana | 1.0/5: 20% soul_shard lord_of_flames, devils_due, accelerando(2)
3:44.284 default Q chaos_bolt Fluffy_Pillow 285120.6/1100000: 26% mana | 2.0/5: 40% soul_shard lord_of_flames, accelerando(2)
3:46.524 default P dimensional_rift Fluffy_Pillow 318162.5/1100000: 29% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando(2)
3:47.646 default R incinerate Fluffy_Pillow 334712.9/1100000: 30% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando(2)
3:48.994 default R incinerate Fluffy_Pillow 288597.1/1100000: 26% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando(2)
3:50.342 default C havoc enemy2 242481.2/1100000: 22% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando(2)
3:51.464 default G immolate Fluffy_Pillow 170590.9/1100000: 16% mana | 1.0/5: 20% soul_shard lord_of_flames
3:52.620 default J conflagrate Fluffy_Pillow 121322.6/1100000: 11% mana | 1.0/5: 20% soul_shard lord_of_flames, accelerando(2)
3:53.741 default K conflagrate Fluffy_Pillow 137858.3/1100000: 13% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, accelerando(2)
3:54.863 default N summon_doomguard Fluffy_Pillow 154650.3/1100000: 14% mana | 3.0/5: 60% soul_shard lord_of_flames, accelerando(3)
3:55.967 default K conflagrate Fluffy_Pillow 171173.0/1100000: 16% mana | 2.0/5: 40% soul_shard lord_of_flames, accelerando(3)
3:57.073 default Q chaos_bolt Fluffy_Pillow 187725.5/1100000: 17% mana | 4.0/5: 80% soul_shard lord_of_flames, conflagration_of_chaos, accelerando(3)
3:59.282 default Q chaos_bolt Fluffy_Pillow 220785.8/1100000: 20% mana | 4.0/5: 80% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
4:00.609 default K conflagrate Fluffy_Pillow 240867.1/1100000: 22% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(4)
4:01.698 default Q chaos_bolt Fluffy_Pillow 257400.0/1100000: 23% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(4)
4:03.005 default R incinerate Fluffy_Pillow 277242.6/1100000: 25% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(4)
4:04.314 default R incinerate Fluffy_Pillow 230670.8/1100000: 21% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
4:05.700 default Q chaos_bolt Fluffy_Pillow 184518.3/1100000: 17% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
4:07.086 default K conflagrate Fluffy_Pillow 204366.6/1100000: 19% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
4:08.227 default O soul_harvest Fluffy_Pillow 221137.4/1100000: 20% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
4:08.389 default Q chaos_bolt Fluffy_Pillow 223527.0/1100000: 20% mana | 2.0/5: 40% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
4:09.735 default R incinerate Fluffy_Pillow 243403.4/1100000: 22% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
4:11.061 default C havoc enemy2 197248.5/1100000: 18% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
4:12.168 default R incinerate Fluffy_Pillow 125816.1/1100000: 11% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
4:13.496 default R incinerate Fluffy_Pillow 79691.1/1100000: 7% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
4:14.823 default S life_tap Fluffy_Pillow 33551.2/1100000: 3% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, accelerando(3)
4:15.931 default E immolate Fluffy_Pillow 380133.7/1100000: 35% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, accelerando(3)
4:17.036 default R incinerate Fluffy_Pillow 330891.9/1100000: 30% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, accelerando(5)
4:18.326 default R incinerate Fluffy_Pillow 284754.1/1100000: 26% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, accelerando(5)
4:19.615 default Q chaos_bolt Fluffy_Pillow 238026.8/1100000: 22% mana | 2.0/5: 40% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos
4:21.923 default R incinerate Fluffy_Pillow 271078.1/1100000: 25% mana | 0.0/5: 0% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
4:23.288 default R incinerate Fluffy_Pillow 224918.7/1100000: 20% mana | 0.0/5: 0% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
4:24.655 default G immolate Fluffy_Pillow 178788.4/1100000: 16% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
4:25.795 default J conflagrate Fluffy_Pillow 129358.6/1100000: 12% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
4:26.935 default K conflagrate Fluffy_Pillow 145928.8/1100000: 13% mana | 2.0/5: 40% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, accelerando
4:28.075 default Q chaos_bolt Fluffy_Pillow 162499.0/1100000: 15% mana | 3.0/5: 60% soul_shard lord_of_flames, accelerando
4:30.350 default K conflagrate Fluffy_Pillow 195566.7/1100000: 18% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando
4:31.489 default C havoc enemy2 212122.3/1100000: 19% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando
4:32.630 default P dimensional_rift Fluffy_Pillow 140707.1/1100000: 13% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando
4:33.770 default Q chaos_bolt Fluffy_Pillow 157523.0/1100000: 14% mana | 3.0/5: 60% soul_shard lord_of_flames, embrace_chaos, accelerando(2)
4:35.117 default K conflagrate Fluffy_Pillow 176877.3/1100000: 16% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando
4:36.258 default Q chaos_bolt Fluffy_Pillow 193462.0/1100000: 18% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
4:37.624 default Q chaos_bolt Fluffy_Pillow 213317.2/1100000: 19% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
4:38.990 default R incinerate Fluffy_Pillow 233172.3/1100000: 21% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
4:40.358 default J conflagrate Fluffy_Pillow 187056.5/1100000: 17% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
4:41.498 default L service_imp Fluffy_Pillow 203626.7/1100000: 19% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando
4:42.637 default P dimensional_rift Fluffy_Pillow 220182.4/1100000: 20% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando
4:43.777 default R incinerate Fluffy_Pillow 236752.6/1100000: 22% mana | 1.0/5: 20% soul_shard lord_of_flames, accelerando
4:45.144 default R incinerate Fluffy_Pillow 190823.4/1100000: 17% mana | 1.0/5: 20% soul_shard lord_of_flames, accelerando(2)
4:46.491 default J conflagrate Fluffy_Pillow 144692.8/1100000: 13% mana | 1.0/5: 20% soul_shard lord_of_flames, nefarious_pact, accelerando(2)
4:47.269 default Q chaos_bolt Fluffy_Pillow 156101.3/1100000: 14% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, nefarious_pact
4:48.872 default E immolate Fluffy_Pillow 179056.2/1100000: 16% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact
4:49.674 default G immolate Fluffy_Pillow 124540.8/1100000: 11% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact
4:50.476 default R incinerate Fluffy_Pillow 70026.3/1100000: 6% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando
4:51.423 default Q chaos_bolt Fluffy_Pillow 17791.2/1100000: 2% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando
4:52.370 default S life_tap Fluffy_Pillow 31556.9/1100000: 3% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(2)
4:53.149 default C havoc enemy2 373047.8/1100000: 34% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(2)
4:53.928 default J conflagrate Fluffy_Pillow 296538.7/1100000: 27% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(2)
4:54.708 default Q chaos_bolt Fluffy_Pillow 308044.4/1100000: 28% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(2)
4:55.641 default R incinerate Fluffy_Pillow 321806.9/1100000: 29% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(2)
4:56.577 default R incinerate Fluffy_Pillow 269613.7/1100000: 25% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(2)
4:57.511 default R incinerate Fluffy_Pillow 217391.0/1100000: 20% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(2)
4:58.444 default R incinerate Fluffy_Pillow 165154.2/1100000: 15% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(3)
4:59.366 default Q chaos_bolt Fluffy_Pillow 113023.7/1100000: 10% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due, accelerando(4)
5:00.906 default J conflagrate Fluffy_Pillow 136404.5/1100000: 12% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due, accelerando(5)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4201 3876 0
Agility 7254 6929 0
Stamina 51511 51511 33365
Intellect 49775 48068 38456 (1278)
Spirit 1 1 0
Health 3090660 3090660 0
Mana 1100000 1100000 0
Soul Shard 5 5 0
Spell Power 49775 48068 0
Crit 13.94% 13.94% 3577
Haste 30.18% 29.18% 10943
Damage / Heal Versatility 5.96% 5.96% 2829
ManaReg per Second 14320 14210 0
Mastery 66.15% 66.15% 5618
Armor 1954 1954 1954
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 904.00
Local Head Eyes of Azj'Aqir
ilevel: 900, stats: { 253 Armor, +3255 Sta, +2170 Int, +1074 Haste, +578 Vers }
Local Neck Radiant String of Scorpid Eyes
ilevel: 900, stats: { +1831 Sta, +2011 Haste, +922 Crit }, enchant: mark_of_the_hidden_satyr
Local Shoulders Pauldrons of Azj'Aqir
ilevel: 900, stats: { 233 Armor, +2442 Sta, +1628 Int, +752 Mastery, +487 Vers }
Local Chest Robes of Fluctuating Energy
ilevel: 900, stats: { 311 Armor, +3255 Sta, +2170 Int, +1145 Haste, +507 Mastery }
Local Waist Man'ari Skullbuckled Cinch
ilevel: 900, stats: { 175 Armor, +2442 Sta, +1628 Int, +699 Haste, +540 Mastery }
Local Legs Leggings of Azj'Aqir
ilevel: 900, stats: { 272 Armor, +3255 Sta, +2170 Int, +932 Crit, +720 Haste }
Local Feet Outcast Wanderer's Footrags
ilevel: 910, stats: { 222 Armor, +2680 Sta, +1786 Int, +864 Crit, +422 Mastery }
Local Wrists Woven Lasher Tendril Bracers
ilevel: 900, stats: { 136 Armor, +1831 Sta, +1221 Int, +644 Haste, +285 Vers }
Local Hands Clutch of Azj'Aqir
ilevel: 900, stats: { 194 Armor, +2442 Sta, +1628 Int, +859 Crit, +380 Mastery }
Local Finger1 Ring of the Scoured Clan
ilevel: 900, stats: { +1831 Sta, +2095 Mastery, +838 Haste }, enchant: { +200 Haste }
Local Finger2 Ring of Braided Stems
ilevel: 905, stats: { +1918 Sta, +1814 Haste, +1209 Vers }, enchant: { +200 Haste }
Local Trinket1 Whispers in the Dark
ilevel: 905, stats: { +2162 Int }
Local Trinket2 Erratic Metronome
ilevel: 900, stats: { +2063 Int }
Local Back Astromancer's Greatcloak
ilevel: 905, stats: { 158 Armor, +1918 Sta, +1278 StrAgiInt, +676 Haste, +270 Vers }, enchant: { +200 Int }
Local Main Hand Scepter of Sargeras
ilevel: 929, weapon: { 7005 - 10509, 3.6 }, stats: { +2843 Int, +4265 Sta, +922 Haste, +922 Mastery, +15509 Int }, relics: { +61 ilevels, +59 ilevels, +61 ilevels }

Talents

Level
15 Backdraft (Destruction Warlock) Roaring Blaze (Destruction Warlock) Shadowburn (Destruction Warlock)
30 Reverse Entropy (Destruction Warlock) Eradication (Destruction Warlock) Empowered Life Tap
45 Demonic Circle Mortal Coil Shadowfury
60 Cataclysm (Destruction Warlock) Fire and Brimstone (Destruction Warlock) Soul Harvest
75 Demon Skin Burning Rush Dark Pact
90 Grimoire of Supremacy Grimoire of Service Grimoire of Sacrifice
100 Wreak Havoc (Destruction Warlock) Channel Demonfire (Destruction Warlock) Soul Conduit

Profile

warlock="Warlock_Destruction_T19M"
level=110
race=troll
role=spell
position=back
talents=2203021
artifact=38:142513:142516:142513:0:803:1:804:3:805:3:806:5:807:3:808:3:809:4:810:3:811:3:812:3:813:1:814:1:815:1:816:1:817:1:818:1:1355:1
spec=destruction

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,type=whispered_pact
actions.precombat+=/food,type=azshari_salad
actions.precombat+=/summon_pet,if=!talent.grimoire_of_supremacy.enabled&(!talent.grimoire_of_sacrifice.enabled|buff.demonic_power.down)
actions.precombat+=/summon_infernal,if=talent.grimoire_of_supremacy.enabled&artifact.lord_of_flames.rank>0
actions.precombat+=/summon_infernal,if=talent.grimoire_of_supremacy.enabled&active_enemies>1
actions.precombat+=/summon_doomguard,if=talent.grimoire_of_supremacy.enabled&active_enemies=1&artifact.lord_of_flames.rank=0
actions.precombat+=/augmentation,type=defiled
actions.precombat+=/snapshot_stats
actions.precombat+=/grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
actions.precombat+=/life_tap,if=talent.empowered_life_tap.enabled&!buff.empowered_life_tap.remains
actions.precombat+=/potion,name=prolonged_power
actions.precombat+=/chaos_bolt

# Executed every time the actor is available.
actions=havoc,target=2,if=active_enemies>1&(active_enemies<4|talent.wreak_havoc.enabled&active_enemies<6)&!debuff.havoc.remains
actions+=/dimensional_rift,if=charges=3
actions+=/immolate,if=remains<=tick_time
actions+=/immolate,cycle_targets=1,if=active_enemies>1&remains<=tick_time&(!talent.roaring_blaze.enabled|(!debuff.roaring_blaze.remains&action.conflagrate.charges<2))
actions+=/immolate,if=talent.roaring_blaze.enabled&remains<=duration&!debuff.roaring_blaze.remains&target.time_to_die>10&(action.conflagrate.charges=2+set_bonus.tier19_4pc|(action.conflagrate.charges>=1+set_bonus.tier19_4pc&action.conflagrate.recharge_time<cast_time+gcd)|target.time_to_die<24)
actions+=/berserking
actions+=/blood_fury
actions+=/arcane_torrent
actions+=/potion,name=deadly_grace,if=(buff.soul_harvest.remains|trinket.proc.any.react|target.time_to_die<=45)
actions+=/shadowburn,if=buff.conflagration_of_chaos.remains<=action.chaos_bolt.cast_time
actions+=/shadowburn,if=(charges=1&recharge_time<action.chaos_bolt.cast_time|charges=2)&soul_shard<5
actions+=/conflagrate,if=talent.roaring_blaze.enabled&(charges=2+set_bonus.tier19_4pc|(charges>=1+set_bonus.tier19_4pc&recharge_time<gcd)|target.time_to_die<24)
actions+=/conflagrate,if=talent.roaring_blaze.enabled&debuff.roaring_blaze.stack>0&dot.immolate.remains>dot.immolate.duration*0.3&(active_enemies=1|soul_shard<3)&soul_shard<5
actions+=/conflagrate,if=!talent.roaring_blaze.enabled&!buff.backdraft.remains&buff.conflagration_of_chaos.remains<=action.chaos_bolt.cast_time
actions+=/conflagrate,if=!talent.roaring_blaze.enabled&!buff.backdraft.remains&(charges=1&recharge_time<action.chaos_bolt.cast_time|charges=2)&soul_shard<5
actions+=/life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<=gcd
actions+=/dimensional_rift,if=equipped.144369&!buff.lessons_of_spacetime.remains&((!talent.grimoire_of_supremacy.enabled&!cooldown.summon_doomguard.remains)|(talent.grimoire_of_service.enabled&!cooldown.service_pet.remains)|(talent.soul_harvest.enabled&!cooldown.soul_harvest.remains))
actions+=/service_pet
actions+=/summon_infernal,if=artifact.lord_of_flames.rank>0&!buff.lord_of_flames.remains
actions+=/summon_doomguard,if=!talent.grimoire_of_supremacy.enabled&spell_targets.infernal_awakening<=2&(target.time_to_die>180|target.health.pct<=20|target.time_to_die<30)
actions+=/summon_infernal,if=!talent.grimoire_of_supremacy.enabled&spell_targets.infernal_awakening>2
actions+=/summon_doomguard,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal=1&artifact.lord_of_flames.rank>0&buff.lord_of_flames.remains&!pet.doomguard.active
actions+=/summon_doomguard,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal=1&equipped.132379&!cooldown.sindorei_spite_icd.remains
actions+=/summon_infernal,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal>1&equipped.132379&!cooldown.sindorei_spite_icd.remains
actions+=/soul_harvest
actions+=/channel_demonfire,if=dot.immolate.remains>cast_time
actions+=/havoc,if=active_enemies=1&talent.wreak_havoc.enabled&equipped.132375&!debuff.havoc.remains
actions+=/rain_of_fire,if=active_enemies>=3&cooldown.havoc.remains<=12&!talent.wreak_havoc.enabled
actions+=/rain_of_fire,if=active_enemies>=6&talent.wreak_havoc.enabled
actions+=/dimensional_rift,if=!equipped.144369|charges>1|((!talent.grimoire_of_service.enabled|recharge_time<cooldown.service_pet.remains)&(!talent.soul_harvest.enabled|recharge_time<cooldown.soul_harvest.remains)&(!talent.grimoire_of_supremacy.enabled|recharge_time<cooldown.summon_doomguard.remains))
actions+=/life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<duration*0.3
actions+=/cataclysm
actions+=/chaos_bolt,if=(cooldown.havoc.remains>12&cooldown.havoc.remains|active_enemies<3|talent.wreak_havoc.enabled&active_enemies<6)
actions+=/shadowburn
actions+=/conflagrate,if=!talent.roaring_blaze.enabled&!buff.backdraft.remains
actions+=/immolate,if=!talent.roaring_blaze.enabled&remains<=duration*0.3
actions+=/incinerate
actions+=/life_tap

head=eyes_of_azjaqir,id=138314,bonus_id=3445
neck=radiant_string_of_scorpid_eyes,id=140898,bonus_id=3445,enchant_id=5439
shoulders=pauldrons_of_azjaqir,id=138323,bonus_id=3445
back=astromancers_greatcloak,id=140909,bonus_id=3518,enchant_id=5436
chest=robes_of_fluctuating_energy,id=140848,bonus_id=3445
wrists=woven_lasher_tendril_bracers,id=140886,bonus_id=3445
hands=clutch_of_azjaqir,id=138311,bonus_id=3445
waist=manari_skullbuckled_cinch,id=140887,bonus_id=3445
legs=leggings_of_azjaqir,id=138317,bonus_id=3445
feet=outcast_wanderers_footrags,id=140914,bonus_id=3519
finger1=ring_of_the_scoured_clan,id=140897,bonus_id=3445,enchant=binding_of_haste
finger2=ring_of_braided_stems,id=140896,bonus_id=3518,enchant=binding_of_haste
trinket1=whispers_in_the_dark,id=140809,ilevel=905
trinket2=erratic_metronome,id=140792,ilevel=900
main_hand=scepter_of_sargeras,id=128941,ilevel=929,gem_id=140826/140837/140826,relic_id=3519/3518:3518/3519

# Gear Summary
# gear_ilvl=903.60
# gear_stamina=33365
# gear_intellect=38456
# gear_crit_rating=3577
# gear_haste_rating=10943
# gear_mastery_rating=5618
# gear_versatility_rating=2829
# gear_armor=1954
# set_bonus=tier19_2pc=1
# set_bonus=tier19_4pc=1
default_pet=imp

Simulation & Raid Information

Iterations: 10003
Threads: 4
Confidence: 95.00%
Fight Length: 221 - 379 ( 301.1 )

Performance:

Total Events Processed: 845147987
Max Event Queue: 1082
Sim Seconds: 3012124
CPU Seconds: 789.8125
Physical Seconds: 211.0023
Speed Up: 3814

Settings:

World Lag: 100 ms ( stddev = 10 ms )
Queue Lag: 5 ms ( stddev = 1 ms )

Raw Ability Summary

Character Unit Ability Id Total DPS Imp/Min Hit Crit Count Impacts Crit% Avoid% G% B% Interval Combined Duration
Alythess' Alythess' augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.12sec
Alythess' Alythess' berserking 26297 0 0 0.00 0 0 2.1 0.0 0.0% 0.0% 0.0% 0.0% 180.66sec 0 301.12sec
Alythess' Alythess' chaos_bolt 116858 97190244 322760 22.20 0 872243 58.4 111.4 100.0% 0.0% 0.0% 0.0% 5.01sec 97190244 301.12sec
Alythess' Alythess' conflagrate 17962 32184865 106883 19.17 190384 442388 48.4 96.2 57.2% 0.0% 0.0% 0.0% 6.21sec 32184865 301.12sec
Alythess' Alythess' deadly_grace 188091 1569336 5212 2.84 92279 184602 14.3 14.3 19.2% 0.0% 0.0% 0.0% 2.08sec 1569336 301.12sec
Alythess' Alythess' dimensional_rift 196586 0 0 0.00 0 0 13.1 0.0 0.0% 0.0% 0.0% 0.0% 23.36sec 0 301.12sec
Alythess' Alythess' flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.12sec
Alythess' Alythess' food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.12sec
Alythess' Alythess' havoc 80240 0 0 0.00 0 0 14.9 0.0 0.0% 0.0% 0.0% 0.0% 20.91sec 0 301.12sec
Alythess' Alythess' immolate 348 7662819 25448 7.69 131267 262509 19.9 38.6 51.2% 0.0% 0.0% 0.0% 15.27sec 70495810 301.12sec
Alythess' Alythess' immolate ticks -348 62832990 209443 58.69 141562 283103 19.9 293.5 51.3% 0.0% 0.0% 0.0% 15.27sec 70495810 301.12sec
Alythess' Alythess' incinerate 29722 39685152 131791 30.37 218230 436634 79.6 152.4 19.3% 0.0% 0.0% 0.0% 3.59sec 39685152 301.12sec
Alythess' Alythess' life_tap 1454 0 0 0.00 0 0 7.5 0.0 0.0% 0.0% 0.0% 0.0% 30.59sec 0 301.12sec
Alythess' Alythess' mark_of_the_hidden_satyr 191259 2673084 8877 3.97 112356 224683 19.9 19.9 19.3% 0.0% 0.0% 0.0% 14.99sec 2673084 301.12sec
Alythess' Alythess' potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.12sec
Alythess' Alythess' service_imp 111859 0 0 0.00 0 0 3.7 0.0 0.0% 0.0% 0.0% 0.0% 91.80sec 0 301.12sec
Alythess' Alythess' soul_harvest 196098 0 0 0.00 0 0 2.9 0.0 0.0% 0.0% 0.0% 0.0% 120.91sec 0 301.12sec
Alythess' Alythess' summon_doomguard 18540 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.12sec
Alythess' Alythess' summon_imp 688 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.12sec
Alythess' Alythess' summon_infernal 1122 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.12sec
Alythess' Alythess'_imp firebolt 3110 12729172 42272 21.51 98869 197791 108.8 107.9 19.3% 0.0% 0.0% 0.0% 2.77sec 12729172 301.12sec
Alythess' Alythess'_service_imp firebolt 3110 11751964 122608 30.58 201660 403688 49.1 48.9 19.2% 0.0% 0.0% 0.0% 5.53sec 11751964 95.85sec
Alythess' Alythess'_infernal immolation ticks -19483 2262549 7542 4.65 40783 81579 1.0 23.3 19.2% 0.0% 0.0% 0.0% 0.00sec 2262549 25.00sec
Alythess' Alythess'_infernal melee 0 641332 25652 52.85 24420 48861 22.0 22.0 19.2% 0.0% 0.0% 0.0% 1.11sec 942818 25.00sec
Alythess' Alythess'_doomguard doom_bolt 85692 2386653 95463 26.28 182571 365529 11.0 11.0 19.3% 0.0% 0.0% 0.0% 2.20sec 2386653 25.00sec
Alythess' Alythess'_lord_of_flames_infernal immolation ticks -19483 2266382 7555 4.65 40781 81596 1.0 23.3 19.4% 0.0% 0.0% 0.0% 0.00sec 2266382 25.00sec
Alythess' Alythess'_lord_of_flames_infernal melee 0 641456 25657 52.85 24420 48866 22.0 22.0 19.3% 0.0% 0.0% 0.0% 1.11sec 943001 25.00sec
Alythess' Alythess'_lord_of_flames_infernal immolation ticks -19483 2264303 7548 4.65 40781 81591 1.0 23.3 19.3% 0.0% 0.0% 0.0% 0.00sec 2264303 25.00sec
Alythess' Alythess'_lord_of_flames_infernal melee 0 641267 25650 52.85 24423 48839 22.0 22.0 19.2% 0.0% 0.0% 0.0% 1.11sec 942723 25.00sec
Alythess' Alythess'_lord_of_flames_infernal immolation ticks -19483 2263873 7546 4.65 40783 81573 1.0 23.3 19.3% 0.0% 0.0% 0.0% 0.00sec 2263873 25.00sec
Alythess' Alythess'_lord_of_flames_infernal melee 0 641678 25666 52.85 24422 48850 22.0 22.0 19.3% 0.0% 0.0% 0.0% 1.11sec 943327 25.00sec
Alythess' Alythess'_shadowy_tear shadow_bolt ticks -196657 6168771 20563 9.72 107082 213972 4.4 48.6 19.2% 0.0% 0.0% 0.0% 59.39sec 6168771 51.82sec
Alythess' Alythess'_chaos_tear chaos_bolt 215279 2881824 137959 12.50 0 662015 4.4 4.4 100.0% 0.0% 0.0% 0.0% 59.83sec 2881824 20.89sec
Alythess' Alythess'_chaos_portal chaos_barrage ticks -187394 5647896 18826 31.14 30560 61118 4.4 155.7 19.3% 0.0% 0.0% 0.0% 57.98sec 5647896 22.95sec
Cloak Cloak augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.12sec
Cloak Cloak berserking 26297 0 0 0.00 0 0 2.1 0.0 0.0% 0.0% 0.0% 0.0% 180.61sec 0 301.12sec
Cloak Cloak chaos_bolt 116858 95531297 317251 21.87 0 870450 57.5 109.7 100.0% 0.0% 0.0% 0.0% 5.07sec 95531297 301.12sec
Cloak Cloak conflagrate 17962 32060192 106469 19.15 195821 445088 48.3 96.1 55.3% 0.0% 0.0% 0.0% 6.21sec 32060192 301.12sec
Cloak Cloak deadly_grace 188091 1544336 5129 2.83 94058 187963 14.2 14.2 15.6% 0.0% 0.0% 0.0% 2.10sec 1544336 301.12sec
Cloak Cloak dimensional_rift 196586 0 0 0.00 0 0 13.2 0.0 0.0% 0.0% 0.0% 0.0% 23.20sec 0 301.12sec
Cloak Cloak flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.12sec
Cloak Cloak food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.12sec
Cloak Cloak havoc 80240 0 0 0.00 0 0 14.9 0.0 0.0% 0.0% 0.0% 0.0% 20.91sec 0 301.12sec
Cloak Cloak immolate 348 7705482 25589 7.69 135184 270445 19.9 38.6 47.7% 0.0% 0.0% 0.0% 15.28sec 70747962 301.12sec
Cloak Cloak immolate ticks -348 63042480 210142 58.61 145631 291381 19.9 293.0 47.7% 0.0% 0.0% 0.0% 15.28sec 70747962 301.12sec
Cloak Cloak incinerate 29722 39852623 132347 30.55 224621 449444 80.1 153.3 15.7% 0.0% 0.0% 0.0% 3.59sec 39852623 301.12sec
Cloak Cloak life_tap 1454 0 0 0.00 0 0 7.6 0.0 0.0% 0.0% 0.0% 0.0% 30.49sec 0 301.12sec
Cloak Cloak mark_of_the_hidden_satyr 191259 2665262 8851 3.97 115705 231549 19.9 19.9 15.6% 0.0% 0.0% 0.0% 15.02sec 2665262 301.12sec
Cloak Cloak potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.12sec
Cloak Cloak service_imp 111859 0 0 0.00 0 0 3.7 0.0 0.0% 0.0% 0.0% 0.0% 91.88sec 0 301.12sec
Cloak Cloak soul_harvest 196098 0 0 0.00 0 0 2.9 0.0 0.0% 0.0% 0.0% 0.0% 120.91sec 0 301.12sec
Cloak Cloak summon_doomguard 18540 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.12sec
Cloak Cloak summon_imp 688 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.12sec
Cloak Cloak summon_infernal 1122 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.12sec
Cloak Cloak_imp firebolt 3110 12690994 42146 21.48 101803 203621 108.6 107.8 15.7% 0.0% 0.0% 0.0% 2.77sec 12690994 301.12sec
Cloak Cloak_service_imp firebolt 3110 11719427 122304 30.54 207644 415491 49.1 48.8 15.7% 0.0% 0.0% 0.0% 5.55sec 11719427 95.82sec
Cloak Cloak_infernal immolation ticks -19483 2254846 7516 4.64 41973 83896 1.0 23.2 15.7% 0.0% 0.0% 0.0% 0.00sec 2254846 25.00sec
Cloak Cloak_infernal melee 0 640303 25611 52.83 25129 50238 22.0 22.0 15.8% 0.0% 0.0% 0.0% 1.11sec 941307 25.00sec
Cloak Cloak_doomguard doom_bolt 85692 2369312 94772 26.17 188060 375558 10.9 10.9 15.6% 0.0% 0.0% 0.0% 2.21sec 2369312 25.00sec
Cloak Cloak_lord_of_flames_infernal immolation ticks -19483 2256323 7521 4.64 41966 83972 1.0 23.2 15.8% 0.0% 0.0% 0.0% 0.00sec 2256323 25.00sec
Cloak Cloak_lord_of_flames_infernal melee 0 639420 25576 52.83 25125 50276 22.0 22.0 15.6% 0.0% 0.0% 0.0% 1.11sec 940008 25.00sec
Cloak Cloak_lord_of_flames_infernal immolation ticks -19483 2254113 7514 4.64 41970 83922 1.0 23.2 15.7% 0.0% 0.0% 0.0% 0.00sec 2254113 25.00sec
Cloak Cloak_lord_of_flames_infernal melee 0 639343 25573 52.83 25126 50265 22.0 22.0 15.6% 0.0% 0.0% 0.0% 1.11sec 939894 25.00sec
Cloak Cloak_lord_of_flames_infernal immolation ticks -19483 2252509 7508 4.64 41968 83944 1.0 23.2 15.6% 0.0% 0.0% 0.0% 0.00sec 2252509 25.00sec
Cloak Cloak_lord_of_flames_infernal melee 0 639626 25584 52.83 25125 50275 22.0 22.0 15.6% 0.0% 0.0% 0.0% 1.11sec 940310 25.00sec
Cloak Cloak_shadowy_tear shadow_bolt ticks -196657 6187316 20624 9.76 110263 220600 4.4 48.8 15.6% 0.0% 0.0% 0.0% 59.49sec 6187316 52.09sec
Cloak Cloak_chaos_tear chaos_bolt 215279 2893248 137496 12.49 0 660740 4.4 4.4 100.0% 0.0% 0.0% 0.0% 58.45sec 2893248 21.04sec
Cloak Cloak_chaos_portal chaos_barrage ticks -187394 5591676 18639 30.90 31442 62881 4.4 154.5 15.7% 0.0% 0.0% 0.0% 58.52sec 5591676 22.78sec
Feretory Feretory augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.12sec
Feretory Feretory berserking 26297 0 0 0.00 0 0 2.1 0.0 0.0% 0.0% 0.0% 0.0% 180.68sec 0 301.12sec
Feretory Feretory chaos_bolt 116858 114906698 381595 26.20 0 873921 68.6 131.5 100.0% 0.0% 0.0% 0.0% 4.26sec 114906698 301.12sec
Feretory Feretory conflagrate 17962 32634742 108377 19.29 200315 450164 48.7 96.8 54.7% 0.0% 0.0% 0.0% 6.17sec 32634742 301.12sec
Feretory Feretory deadly_grace 188091 1542935 5124 2.85 94572 188936 14.3 14.3 14.0% 0.0% 0.0% 0.0% 2.08sec 1542935 301.12sec
Feretory Feretory dimensional_rift 196586 0 0 0.00 0 0 12.8 0.0 0.0% 0.0% 0.0% 0.0% 23.93sec 0 301.12sec
Feretory Feretory flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.12sec
Feretory Feretory food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.12sec
Feretory Feretory havoc 80240 0 0 0.00 0 0 14.9 0.0 0.0% 0.0% 0.0% 0.0% 20.87sec 0 301.12sec
Feretory Feretory immolate 348 7801958 25910 7.74 137793 275570 20.1 38.8 45.8% 0.0% 0.0% 0.0% 15.11sec 71441807 301.12sec
Feretory Feretory immolate ticks -348 63639849 212133 59.13 147474 294872 20.1 295.7 46.0% 0.0% 0.0% 0.0% 15.11sec 71441807 301.12sec
Feretory Feretory incinerate 29722 36288509 120511 27.78 228289 456711 73.0 139.4 14.0% 0.0% 0.0% 0.0% 3.91sec 36288509 301.12sec
Feretory Feretory life_tap 1454 0 0 0.00 0 0 6.2 0.0 0.0% 0.0% 0.0% 0.0% 34.96sec 0 301.12sec
Feretory Feretory mark_of_the_hidden_satyr 191259 2682470 8908 4.01 116904 233722 20.1 20.1 14.0% 0.0% 0.0% 0.0% 14.91sec 2682470 301.12sec
Feretory Feretory potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.12sec
Feretory Feretory service_imp 111859 0 0 0.00 0 0 3.7 0.0 0.0% 0.0% 0.0% 0.0% 91.64sec 0 301.12sec
Feretory Feretory soul_harvest 196098 0 0 0.00 0 0 2.9 0.0 0.0% 0.0% 0.0% 0.0% 120.82sec 0 301.12sec
Feretory Feretory summon_doomguard 18540 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.12sec
Feretory Feretory summon_imp 688 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.12sec
Feretory Feretory summon_infernal 1122 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.12sec
Feretory Feretory_imp firebolt 3110 12734161 42289 21.64 102881 205809 109.5 108.6 13.9% 0.0% 0.0% 0.0% 2.75sec 12734161 301.12sec
Feretory Feretory_service_imp firebolt 3110 11743779 122346 30.69 209869 419653 49.4 49.1 14.0% 0.0% 0.0% 0.0% 5.51sec 11743779 95.99sec
Feretory Feretory_infernal immolation ticks -19483 2263312 7544 4.68 42407 84846 1.0 23.4 13.9% 0.0% 0.0% 0.0% 0.00sec 2263312 25.00sec
Feretory Feretory_infernal melee 0 641588 25662 53.21 25399 50819 22.2 22.2 13.9% 0.0% 0.0% 0.0% 1.10sec 943195 25.00sec
Feretory Feretory_doomguard doom_bolt 85692 2397972 95916 26.57 189992 379859 11.1 11.1 14.0% 0.0% 0.0% 0.0% 2.18sec 2397972 25.00sec
Feretory Feretory_lord_of_flames_infernal immolation ticks -19483 2263745 7546 4.68 42410 84804 1.0 23.4 14.0% 0.0% 0.0% 0.0% 0.00sec 2263745 25.00sec
Feretory Feretory_lord_of_flames_infernal melee 0 642188 25686 53.21 25400 50815 22.2 22.2 14.0% 0.0% 0.0% 0.0% 1.10sec 944077 25.00sec
Feretory Feretory_lord_of_flames_infernal immolation ticks -19483 2263651 7546 4.68 42409 84823 1.0 23.4 13.9% 0.0% 0.0% 0.0% 0.00sec 2263651 25.00sec
Feretory Feretory_lord_of_flames_infernal melee 0 641539 25661 53.21 25399 50820 22.2 22.2 13.9% 0.0% 0.0% 0.0% 1.10sec 943123 25.00sec
Feretory Feretory_lord_of_flames_infernal immolation ticks -19483 2263375 7545 4.68 42408 84823 1.0 23.4 13.9% 0.0% 0.0% 0.0% 0.00sec 2263375 25.00sec
Feretory Feretory_lord_of_flames_infernal melee 0 641379 25654 53.21 25400 50811 22.2 22.2 13.9% 0.0% 0.0% 0.0% 1.10sec 942889 25.00sec
Feretory Feretory_shadowy_tear shadow_bolt ticks -196657 6078858 20263 9.59 111904 223847 4.3 47.9 14.0% 0.0% 0.0% 0.0% 61.19sec 6078858 51.16sec
Feretory Feretory_chaos_tear chaos_bolt 215279 2789567 137300 12.51 0 658397 4.3 4.2 100.0% 0.0% 0.0% 0.0% 60.39sec 2789567 20.32sec
Feretory Feretory_chaos_portal chaos_barrage ticks -187394 5549459 18498 30.77 31810 63612 4.3 153.9 13.9% 0.0% 0.0% 0.0% 60.06sec 5549459 22.46sec
KJ_Trinket KJ_Trinket augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.12sec
KJ_Trinket KJ_Trinket berserking 26297 0 0 0.00 0 0 2.1 0.0 0.0% 0.0% 0.0% 0.0% 180.45sec 0 301.12sec
KJ_Trinket KJ_Trinket chaos_bolt 116858 96258895 319667 21.54 0 890436 56.8 108.1 100.0% 0.0% 0.0% 0.0% 5.15sec 96258895 301.12sec
KJ_Trinket KJ_Trinket conflagrate 17962 32401414 107602 18.99 201202 455718 47.9 95.3 54.5% 0.0% 0.0% 0.0% 6.27sec 32401414 301.12sec
KJ_Trinket KJ_Trinket deadly_grace 188091 1536349 5102 2.81 94523 189162 14.1 14.1 15.1% 0.0% 0.0% 0.0% 2.10sec 1536349 301.12sec
KJ_Trinket KJ_Trinket dimensional_rift 196586 0 0 0.00 0 0 13.1 0.0 0.0% 0.0% 0.0% 0.0% 23.33sec 0 301.12sec
KJ_Trinket KJ_Trinket flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.12sec
KJ_Trinket KJ_Trinket food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.12sec
KJ_Trinket KJ_Trinket havoc 80240 0 0 0.00 0 0 14.9 0.0 0.0% 0.0% 0.0% 0.0% 20.94sec 0 301.12sec
KJ_Trinket KJ_Trinket immolate 348 7791221 25874 7.63 138488 276855 19.8 38.3 46.9% 0.0% 0.0% 0.0% 15.42sec 71325367 301.12sec
KJ_Trinket KJ_Trinket immolate ticks -348 63534146 211780 58.02 148871 297983 19.8 290.1 47.0% 0.0% 0.0% 0.0% 15.42sec 71325367 301.12sec
KJ_Trinket KJ_Trinket incinerate 29722 40295158 133817 30.23 230758 461680 79.0 151.7 15.1% 0.0% 0.0% 0.0% 3.62sec 40295158 301.12sec
KJ_Trinket KJ_Trinket kiljaedens_burning_wish 235999 7496995 24897 1.78 0 838600 4.5 8.9 100.0% 0.0% 0.0% 0.0% 75.50sec 7496995 301.12sec
KJ_Trinket KJ_Trinket life_tap 1454 0 0 0.00 0 0 7.5 0.0 0.0% 0.0% 0.0% 0.0% 30.68sec 0 301.12sec
KJ_Trinket KJ_Trinket mark_of_the_hidden_satyr 191259 2677157 8891 3.94 117353 234690 19.8 19.8 15.3% 0.0% 0.0% 0.0% 15.22sec 2677157 301.12sec
KJ_Trinket KJ_Trinket potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.12sec
KJ_Trinket KJ_Trinket service_imp 111859 0 0 0.00 0 0 3.7 0.0 0.0% 0.0% 0.0% 0.0% 91.84sec 0 301.12sec
KJ_Trinket KJ_Trinket soul_harvest 196098 0 0 0.00 0 0 2.9 0.0 0.0% 0.0% 0.0% 0.0% 120.90sec 0 301.12sec
KJ_Trinket KJ_Trinket summon_doomguard 18540 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.12sec
KJ_Trinket KJ_Trinket summon_imp 688 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.12sec
KJ_Trinket KJ_Trinket summon_infernal 1122 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.12sec
KJ_Trinket KJ_Trinket_imp firebolt 3110 12688991 42139 21.28 103225 206444 107.6 106.8 15.1% 0.0% 0.0% 0.0% 2.80sec 12688991 301.12sec
KJ_Trinket KJ_Trinket_service_imp firebolt 3110 11604123 121106 29.97 210506 421030 48.1 47.9 15.2% 0.0% 0.0% 0.0% 5.64sec 11604123 95.82sec
KJ_Trinket KJ_Trinket_infernal immolation ticks -19483 2260860 7536 4.63 42455 84893 1.0 23.1 15.1% 0.0% 0.0% 0.0% 0.00sec 2260860 25.00sec
KJ_Trinket KJ_Trinket_infernal melee 0 642902 25715 52.80 25382 50790 22.0 22.0 15.1% 0.0% 0.0% 0.0% 1.12sec 945127 25.00sec
KJ_Trinket KJ_Trinket_doomguard doom_bolt 85692 2316229 92647 25.30 190832 381652 10.5 10.5 15.2% 0.0% 0.0% 0.0% 2.22sec 2316229 25.00sec
KJ_Trinket KJ_Trinket_lord_of_flames_infernal immolation ticks -19483 2260388 7535 4.63 42455 84891 1.0 23.1 15.1% 0.0% 0.0% 0.0% 0.00sec 2260388 25.00sec
KJ_Trinket KJ_Trinket_lord_of_flames_infernal melee 0 642568 25702 52.80 25383 50781 22.0 22.0 15.1% 0.0% 0.0% 0.0% 1.12sec 944636 25.00sec
KJ_Trinket KJ_Trinket_lord_of_flames_infernal immolation ticks -19483 2261391 7538 4.63 42457 84875 1.0 23.1 15.2% 0.0% 0.0% 0.0% 0.00sec 2261391 25.00sec
KJ_Trinket KJ_Trinket_lord_of_flames_infernal melee 0 643246 25729 52.80 25383 50781 22.0 22.0 15.2% 0.0% 0.0% 0.0% 1.12sec 945633 25.00sec
KJ_Trinket KJ_Trinket_lord_of_flames_infernal immolation ticks -19483 2257683 7526 4.63 42455 84897 1.0 23.1 15.0% 0.0% 0.0% 0.0% 0.00sec 2257683 25.00sec
KJ_Trinket KJ_Trinket_lord_of_flames_infernal melee 0 642970 25718 52.80 25385 50760 22.0 22.0 15.1% 0.0% 0.0% 0.0% 1.12sec 945227 25.00sec
KJ_Trinket KJ_Trinket_shadowy_tear shadow_bolt ticks -196657 6198065 20660 9.73 111267 222674 4.4 48.7 15.1% 0.0% 0.0% 0.0% 59.00sec 6198065 52.13sec
KJ_Trinket KJ_Trinket_chaos_tear chaos_bolt 215279 2926289 139046 12.50 0 667323 4.4 4.4 100.0% 0.0% 0.0% 0.0% 59.44sec 2926289 21.05sec
KJ_Trinket KJ_Trinket_chaos_portal chaos_barrage ticks -187394 5571636 18572 30.37 32047 64116 4.4 151.9 15.1% 0.0% 0.0% 0.0% 59.32sec 5571636 22.72sec
Magistrike Magistrike augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.12sec
Magistrike Magistrike berserking 26297 0 0 0.00 0 0 2.1 0.0 0.0% 0.0% 0.0% 0.0% 180.52sec 0 301.12sec
Magistrike Magistrike chaos_bolt 116858 95801148 318147 21.68 0 880619 57.1 108.8 100.0% 0.0% 0.0% 0.0% 5.12sec 95801148 301.12sec
Magistrike Magistrike conflagrate 17962 32108753 106630 19.03 198079 449936 48.0 95.5 54.9% 0.0% 0.0% 0.0% 6.26sec 32108753 301.12sec
Magistrike Magistrike deadly_grace 188091 1541140 5118 2.82 94046 188188 14.2 14.2 15.7% 0.0% 0.0% 0.0% 2.10sec 1541140 301.12sec
Magistrike Magistrike dimensional_rift 196586 0 0 0.00 0 0 13.1 0.0 0.0% 0.0% 0.0% 0.0% 23.33sec 0 301.12sec
Magistrike Magistrike flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.12sec
Magistrike Magistrike food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.12sec
Magistrike Magistrike havoc 80240 0 0 0.00 0 0 14.9 0.0 0.0% 0.0% 0.0% 0.0% 20.93sec 0 301.12sec
Magistrike Magistrike immolate 348 7719069 25634 7.65 136291 272642 19.8 38.4 47.6% 0.0% 0.0% 0.0% 15.39sec 70770055 301.12sec
Magistrike Magistrike immolate ticks -348 63050987 210170 58.18 146751 293560 19.8 290.9 47.7% 0.0% 0.0% 0.0% 15.39sec 70770055 301.12sec
Magistrike Magistrike incinerate 29722 40007616 132862 30.32 227333 454501 79.3 152.2 15.6% 0.0% 0.0% 0.0% 3.61sec 40007616 301.12sec
Magistrike Magistrike life_tap 1454 0 0 0.00 0 0 7.5 0.0 0.0% 0.0% 0.0% 0.0% 30.60sec 0 301.12sec
Magistrike Magistrike mark_of_the_hidden_satyr 191259 2655150 8818 3.95 115746 231625 19.8 19.8 15.7% 0.0% 0.0% 0.0% 15.09sec 2655150 301.12sec
Magistrike Magistrike potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.12sec
Magistrike Magistrike service_imp 111859 0 0 0.00 0 0 3.7 0.0 0.0% 0.0% 0.0% 0.0% 91.79sec 0 301.12sec
Magistrike Magistrike soul_harvest 196098 0 0 0.00 0 0 2.9 0.0 0.0% 0.0% 0.0% 0.0% 120.93sec 0 301.12sec
Magistrike Magistrike summon_doomguard 18540 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.12sec
Magistrike Magistrike summon_imp 688 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.12sec
Magistrike Magistrike summon_infernal 1122 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.12sec
Magistrike Magistrike_imp firebolt 3110 12612049 41884 21.33 101899 203737 107.9 107.0 15.7% 0.0% 0.0% 0.0% 2.79sec 12612049 301.12sec
Magistrike Magistrike_service_imp firebolt 3110 11621740 121278 30.26 207867 415527 48.6 48.3 15.7% 0.0% 0.0% 0.0% 5.59sec 11621740 95.83sec
Magistrike Magistrike_infernal immolation ticks -19483 2244471 7482 4.63 41948 83904 1.0 23.1 15.7% 0.0% 0.0% 0.0% 0.00sec 2244471 25.00sec
Magistrike Magistrike_infernal melee 0 638765 25550 52.80 25100 50191 22.0 22.0 15.7% 0.0% 0.0% 0.0% 1.12sec 939045 25.00sec
Magistrike Magistrike_doomguard doom_bolt 85692 2327338 93094 25.69 188250 376165 10.7 10.7 15.5% 0.0% 0.0% 0.0% 2.22sec 2327338 25.00sec
Magistrike Magistrike_lord_of_flames_infernal immolation ticks -19483 2244220 7481 4.63 41949 83890 1.0 23.1 15.7% 0.0% 0.0% 0.0% 0.00sec 2244220 25.00sec
Magistrike Magistrike_lord_of_flames_infernal melee 0 638506 25539 52.80 25097 50221 22.0 22.0 15.6% 0.0% 0.0% 0.0% 1.12sec 938664 25.00sec
Magistrike Magistrike_lord_of_flames_infernal immolation ticks -19483 2245882 7486 4.63 41947 83914 1.0 23.1 15.8% 0.0% 0.0% 0.0% 0.00sec 2245882 25.00sec
Magistrike Magistrike_lord_of_flames_infernal melee 0 638267 25530 52.80 25101 50186 22.0 22.0 15.6% 0.0% 0.0% 0.0% 1.12sec 938313 25.00sec
Magistrike Magistrike_lord_of_flames_infernal immolation ticks -19483 2243349 7478 4.63 41950 83879 1.0 23.1 15.6% 0.0% 0.0% 0.0% 0.00sec 2243349 25.00sec
Magistrike Magistrike_lord_of_flames_infernal melee 0 638947 25557 52.80 25099 50205 22.0 22.0 15.7% 0.0% 0.0% 0.0% 1.12sec 939313 25.00sec
Magistrike Magistrike_shadowy_tear shadow_bolt ticks -196657 6153832 20513 9.72 110099 219831 4.4 48.6 15.7% 0.0% 0.0% 0.0% 59.31sec 6153832 52.07sec
Magistrike Magistrike_chaos_tear chaos_bolt 215279 2880192 137909 12.51 0 661382 4.4 4.4 100.0% 0.0% 0.0% 0.0% 59.44sec 2880192 20.88sec
Magistrike Magistrike_chaos_portal chaos_barrage ticks -187394 5573860 18580 30.79 31452 62940 4.4 154.0 15.7% 0.0% 0.0% 0.0% 57.96sec 5573860 22.90sec
Norgannon's Norgannon's augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.12sec
Norgannon's Norgannon's berserking 26297 0 0 0.00 0 0 2.1 0.0 0.0% 0.0% 0.0% 0.0% 180.65sec 0 301.12sec
Norgannon's Norgannon's chaos_bolt 116858 94789139 314786 22.19 0 850986 57.9 111.4 100.0% 0.0% 0.0% 0.0% 5.05sec 94789139 301.12sec
Norgannon's Norgannon's conflagrate 17962 32104282 106616 19.48 198331 438907 49.2 97.7 54.1% 0.0% 0.0% 0.0% 6.10sec 32104282 301.12sec
Norgannon's Norgannon's deadly_grace 188091 1538834 5110 2.90 94545 189015 14.6 14.6 11.8% 0.0% 0.0% 0.0% 2.04sec 1538834 301.12sec
Norgannon's Norgannon's dimensional_rift 196586 0 0 0.00 0 0 13.3 0.0 0.0% 0.0% 0.0% 0.0% 22.85sec 0 301.12sec
Norgannon's Norgannon's flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.12sec
Norgannon's Norgannon's food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.12sec
Norgannon's Norgannon's havoc 80240 0 0 0.00 0 0 14.9 0.0 0.0% 0.0% 0.0% 0.0% 20.90sec 0 301.12sec
Norgannon's Norgannon's immolate 348 7664071 25452 7.77 136664 273401 20.3 39.0 43.8% 0.0% 0.0% 0.0% 14.95sec 71693295 301.12sec
Norgannon's Norgannon's immolate ticks -348 64029223 213431 59.95 148514 297204 20.3 299.8 43.8% 0.0% 0.0% 0.0% 14.95sec 71693295 301.12sec
Norgannon's Norgannon's incinerate 29722 40259448 133698 31.59 227298 454697 83.1 158.5 11.7% 0.0% 0.0% 0.0% 3.45sec 40259448 301.12sec
Norgannon's Norgannon's life_tap 1454 0 0 0.00 0 0 8.0 0.0 0.0% 0.0% 0.0% 0.0% 29.14sec 0 301.12sec
Norgannon's Norgannon's mark_of_the_hidden_satyr 191259 2662761 8843 4.07 116475 232975 20.4 20.4 11.8% 0.0% 0.0% 0.0% 14.61sec 2662761 301.12sec
Norgannon's Norgannon's potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.12sec
Norgannon's Norgannon's service_imp 111859 0 0 0.00 0 0 3.7 0.0 0.0% 0.0% 0.0% 0.0% 91.91sec 0 301.12sec
Norgannon's Norgannon's soul_harvest 196098 0 0 0.00 0 0 2.9 0.0 0.0% 0.0% 0.0% 0.0% 121.08sec 0 301.12sec
Norgannon's Norgannon's summon_doomguard 18540 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.12sec
Norgannon's Norgannon's summon_imp 688 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.12sec
Norgannon's Norgannon's summon_infernal 1122 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.12sec
Norgannon's Norgannon's_imp firebolt 3110 12616143 41897 21.93 102515 205001 110.9 110.0 11.8% 0.0% 0.0% 0.0% 2.72sec 12616143 301.12sec
Norgannon's Norgannon's_service_imp firebolt 3110 11488261 119933 30.74 209511 419237 49.4 49.1 11.7% 0.0% 0.0% 0.0% 5.51sec 11488261 95.79sec
Norgannon's Norgannon's_infernal immolation ticks -19483 2260052 7534 4.79 42229 84512 1.0 23.9 11.8% 0.0% 0.0% 0.0% 0.00sec 2260052 25.00sec
Norgannon's Norgannon's_infernal melee 0 643816 25752 54.71 25273 50529 22.8 22.8 11.7% 0.0% 0.0% 0.0% 1.08sec 946471 25.00sec
Norgannon's Norgannon's_doomguard doom_bolt 85692 2366187 94646 26.83 189316 379233 11.2 11.2 11.8% 0.0% 0.0% 0.0% 2.16sec 2366187 25.00sec
Norgannon's Norgannon's_lord_of_flames_infernal immolation ticks -19483 2259979 7533 4.79 42230 84502 1.0 23.9 11.8% 0.0% 0.0% 0.0% 0.00sec 2259979 25.00sec
Norgannon's Norgannon's_lord_of_flames_infernal melee 0 644424 25776 54.71 25273 50531 22.8 22.8 11.9% 0.0% 0.0% 0.0% 1.08sec 947364 25.00sec
Norgannon's Norgannon's_lord_of_flames_infernal immolation ticks -19483 2259922 7533 4.79 42233 84447 1.0 23.9 11.8% 0.0% 0.0% 0.0% 0.00sec 2259922 25.00sec
Norgannon's Norgannon's_lord_of_flames_infernal melee 0 644057 25761 54.71 25273 50533 22.8 22.8 11.8% 0.0% 0.0% 0.0% 1.08sec 946825 25.00sec
Norgannon's Norgannon's_lord_of_flames_infernal immolation ticks -19483 2259979 7533 4.79 42231 84476 1.0 23.9 11.8% 0.0% 0.0% 0.0% 0.00sec 2259979 25.00sec
Norgannon's Norgannon's_lord_of_flames_infernal melee 0 643760 25749 54.71 25269 50586 22.8 22.8 11.7% 0.0% 0.0% 0.0% 1.08sec 946389 25.00sec
Norgannon's Norgannon's_shadowy_tear shadow_bolt ticks -196657 6258839 20863 10.06 111943 223717 4.5 50.3 11.8% 0.0% 0.0% 0.0% 57.90sec 6258839 52.80sec
Norgannon's Norgannon's_chaos_tear chaos_bolt 215279 2840390 134177 12.52 0 642991 4.4 4.4 100.0% 0.0% 0.0% 0.0% 58.02sec 2840390 21.17sec
Norgannon's Norgannon's_chaos_portal chaos_barrage ticks -187394 5634473 18782 31.97 31689 63404 4.5 159.9 11.8% 0.0% 0.0% 0.0% 58.43sec 5634473 23.09sec
Portal_Pants Portal_Pants augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.12sec
Portal_Pants Portal_Pants berserking 26297 0 0 0.00 0 0 2.1 0.0 0.0% 0.0% 0.0% 0.0% 180.58sec 0 301.12sec
Portal_Pants Portal_Pants chaos_bolt 116858 97864446 324999 21.18 0 920663 55.7 106.3 100.0% 0.0% 0.0% 0.0% 5.24sec 97864446 301.12sec
Portal_Pants Portal_Pants conflagrate 17962 32537176 108053 18.61 206548 470293 47.0 93.4 53.8% 0.0% 0.0% 0.0% 6.39sec 32537176 301.12sec
Portal_Pants Portal_Pants deadly_grace 188091 1520109 5048 2.76 94598 189159 13.8 13.8 16.1% 0.0% 0.0% 0.0% 2.14sec 1520109 301.12sec
Portal_Pants Portal_Pants dimensional_rift 196586 0 0 0.00 0 0 13.0 0.0 0.0% 0.0% 0.0% 0.0% 23.53sec 0 301.12sec
Portal_Pants Portal_Pants flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.12sec
Portal_Pants Portal_Pants food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.12sec
Portal_Pants Portal_Pants havoc 80240 0 0 0.00 0 0 14.9 0.0 0.0% 0.0% 0.0% 0.0% 20.94sec 0 301.12sec
Portal_Pants Portal_Pants immolate 348 7944211 26382 7.51 142443 284910 19.6 37.7 47.9% 0.0% 0.0% 0.0% 15.58sec 71035755 301.12sec
Portal_Pants Portal_Pants immolate ticks -348 63091544 210305 56.67 150657 300994 19.6 283.3 47.9% 0.0% 0.0% 0.0% 15.58sec 71035755 301.12sec
Portal_Pants Portal_Pants incinerate 29722 40425259 134249 29.27 237450 474801 76.4 146.9 15.9% 0.0% 0.0% 0.0% 3.75sec 40425259 301.12sec
Portal_Pants Portal_Pants life_tap 1454 0 0 0.00 0 0 7.2 0.0 0.0% 0.0% 0.0% 0.0% 31.55sec 0 301.12sec
Portal_Pants Portal_Pants mark_of_the_hidden_satyr 191259 2623681 8713 3.83 117676 235378 19.2 19.2 15.9% 0.0% 0.0% 0.0% 15.59sec 2623681 301.12sec
Portal_Pants Portal_Pants potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.12sec
Portal_Pants Portal_Pants service_imp 111859 0 0 0.00 0 0 3.7 0.0 0.0% 0.0% 0.0% 0.0% 91.85sec 0 301.12sec
Portal_Pants Portal_Pants soul_harvest 196098 0 0 0.00 0 0 2.9 0.0 0.0% 0.0% 0.0% 0.0% 120.99sec 0 301.12sec
Portal_Pants Portal_Pants summon_doomguard 18540 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.12sec
Portal_Pants Portal_Pants summon_imp 688 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.12sec
Portal_Pants Portal_Pants summon_infernal 1122 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.12sec
Portal_Pants Portal_Pants_imp firebolt 3110 12526530 41600 20.81 103489 206938 105.2 104.4 15.9% 0.0% 0.0% 0.0% 2.86sec 12526530 301.12sec
Portal_Pants Portal_Pants_service_imp firebolt 3110 11439388 119432 29.21 211640 423317 46.9 46.6 15.9% 0.0% 0.0% 0.0% 5.79sec 11439388 95.78sec
Portal_Pants Portal_Pants_infernal immolation ticks -19483 2223109 7410 4.49 42710 85387 1.0 22.5 15.9% 0.0% 0.0% 0.0% 0.00sec 2223109 25.00sec
Portal_Pants Portal_Pants_infernal melee 0 630549 25221 51.02 25573 51177 21.3 21.3 16.0% 0.0% 0.0% 0.0% 1.15sec 926967 25.00sec
Portal_Pants Portal_Pants_doomguard doom_bolt 85692 2312692 92506 25.02 191521 382803 10.4 10.4 15.8% 0.0% 0.0% 0.0% 2.27sec 2312692 25.00sec
Portal_Pants Portal_Pants_lord_of_flames_infernal immolation ticks -19483 2221858 7406 4.49 42707 85421 1.0 22.5 15.9% 0.0% 0.0% 0.0% 0.00sec 2221858 25.00sec
Portal_Pants Portal_Pants_lord_of_flames_infernal melee 0 629639 25185 51.02 25578 51116 21.3 21.3 15.8% 0.0% 0.0% 0.0% 1.15sec 925629 25.00sec
Portal_Pants Portal_Pants_lord_of_flames_infernal immolation ticks -19483 2221582 7405 4.49 42708 85408 1.0 22.5 15.9% 0.0% 0.0% 0.0% 0.00sec 2221582 25.00sec
Portal_Pants Portal_Pants_lord_of_flames_infernal melee 0 631192 25247 51.02 25573 51169 21.3 21.3 16.1% 0.0% 0.0% 0.0% 1.15sec 927911 25.00sec
Portal_Pants Portal_Pants_lord_of_flames_infernal immolation ticks -19483 2221518 7405 4.49 42707 85421 1.0 22.5 15.8% 0.0% 0.0% 0.0% 0.00sec 2221518 25.00sec
Portal_Pants Portal_Pants_lord_of_flames_infernal melee 0 630591 25223 51.02 25574 51167 21.3 21.3 16.0% 0.0% 0.0% 0.0% 1.15sec 927029 25.00sec
Portal_Pants Portal_Pants_shadowy_tear shadow_bolt ticks -196657 6064215 20214 9.31 113006 225856 4.4 46.6 15.9% 0.0% 0.0% 0.0% 59.37sec 6064215 51.66sec
Portal_Pants Portal_Pants_chaos_tear chaos_bolt 215279 2895620 140476 12.50 0 674220 4.3 4.3 100.0% 0.0% 0.0% 0.0% 59.18sec 2895620 20.61sec
Portal_Pants Portal_Pants_chaos_portal chaos_barrage ticks -187394 5437355 18125 29.52 31955 63867 4.3 147.6 15.9% 0.0% 0.0% 0.0% 59.77sec 5437355 22.51sec
Prydaz Prydaz augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.12sec
Prydaz Prydaz berserking 26297 0 0 0.00 0 0 2.1 0.0 0.0% 0.0% 0.0% 0.0% 180.54sec 0 301.12sec
Prydaz Prydaz chaos_bolt 116858 98266744 326335 21.75 0 900039 57.3 109.2 100.0% 0.0% 0.0% 0.0% 5.11sec 98266744 301.12sec
Prydaz Prydaz conflagrate 17962 32962382 109465 19.07 202932 460479 48.1 95.7 54.9% 0.0% 0.0% 0.0% 6.24sec 32962382 301.12sec
Prydaz Prydaz deadly_grace 188091 1547100 5138 2.83 94582 189227 14.2 14.2 15.3% 0.0% 0.0% 0.0% 2.09sec 1547100 301.12sec
Prydaz Prydaz dimensional_rift 196586 0 0 0.00 0 0 13.1 0.0 0.0% 0.0% 0.0% 0.0% 23.24sec 0 301.12sec
Prydaz Prydaz flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.12sec
Prydaz Prydaz food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.12sec
Prydaz Prydaz havoc 80240 0 0 0.00 0 0 14.9 0.0 0.0% 0.0% 0.0% 0.0% 20.92sec 0 301.12sec
Prydaz Prydaz immolate 348 7918430 26296 7.66 139835 279713 19.8 38.4 47.3% 0.0% 0.0% 0.0% 15.35sec 72722856 301.12sec
Prydaz Prydaz immolate ticks -348 64804426 216015 58.33 150661 301374 19.8 291.7 47.5% 0.0% 0.0% 0.0% 15.35sec 72722856 301.12sec
Prydaz Prydaz incinerate 29722 41004131 136171 30.39 232956 465968 79.5 152.5 15.4% 0.0% 0.0% 0.0% 3.60sec 41004131 301.12sec
Prydaz Prydaz life_tap 1454 0 0 0.00 0 0 7.6 0.0 0.0% 0.0% 0.0% 0.0% 30.38sec 0 301.12sec
Prydaz Prydaz mark_of_the_hidden_satyr 191259 2640152 8768 3.96 115117 230419 19.9 19.9 15.3% 0.0% 0.0% 0.0% 15.07sec 2640152 301.12sec
Prydaz Prydaz potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.12sec
Prydaz Prydaz service_imp 111859 0 0 0.00 0 0 3.7 0.0 0.0% 0.0% 0.0% 0.0% 91.82sec 0 301.12sec
Prydaz Prydaz soul_harvest 196098 0 0 0.00 0 0 2.9 0.0 0.0% 0.0% 0.0% 0.0% 120.91sec 0 301.12sec
Prydaz Prydaz summon_doomguard 18540 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.12sec
Prydaz Prydaz summon_imp 688 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.12sec
Prydaz Prydaz summon_infernal 1122 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.12sec
Prydaz Prydaz_imp firebolt 3110 12544603 41660 21.38 101325 202629 108.1 107.3 15.4% 0.0% 0.0% 0.0% 2.78sec 12544603 301.12sec
Prydaz Prydaz_service_imp firebolt 3110 11558132 120614 30.36 206670 413353 48.8 48.5 15.3% 0.0% 0.0% 0.0% 5.57sec 11558132 95.83sec
Prydaz Prydaz_infernal immolation ticks -19483 2231826 7439 4.64 41749 83466 1.0 23.2 15.3% 0.0% 0.0% 0.0% 0.00sec 2231826 25.00sec
Prydaz Prydaz_infernal melee 0 634903 25395 52.80 24980 50011 22.0 22.0 15.5% 0.0% 0.0% 0.0% 1.11sec 933367 25.00sec
Prydaz Prydaz_doomguard doom_bolt 85692 2327747 93108 25.85 187089 374239 10.8 10.8 15.5% 0.0% 0.0% 0.0% 2.21sec 2327747 25.00sec
Prydaz Prydaz_lord_of_flames_infernal immolation ticks -19483 2234032 7447 4.64 41750 83460 1.0 23.2 15.4% 0.0% 0.0% 0.0% 0.00sec 2234032 25.00sec
Prydaz Prydaz_lord_of_flames_infernal melee 0 634418 25376 52.80 24983 49983 22.0 22.0 15.4% 0.0% 0.0% 0.0% 1.11sec 932654 25.00sec
Prydaz Prydaz_lord_of_flames_infernal immolation ticks -19483 2235507 7452 4.64 41746 83499 1.0 23.2 15.5% 0.0% 0.0% 0.0% 0.00sec 2235507 25.00sec
Prydaz Prydaz_lord_of_flames_infernal melee 0 633632 25344 52.80 24984 49968 22.0 22.0 15.3% 0.0% 0.0% 0.0% 1.11sec 931499 25.00sec
Prydaz Prydaz_lord_of_flames_infernal immolation ticks -19483 2232743 7442 4.64 41748 83480 1.0 23.2 15.4% 0.0% 0.0% 0.0% 0.00sec 2232743 25.00sec
Prydaz Prydaz_lord_of_flames_infernal melee 0 633827 25352 52.80 24984 49969 22.0 22.0 15.3% 0.0% 0.0% 0.0% 1.11sec 931785 25.00sec
Prydaz Prydaz_shadowy_tear shadow_bolt ticks -196657 6106137 20354 9.72 109494 218954 4.4 48.6 15.4% 0.0% 0.0% 0.0% 59.54sec 6106137 52.10sec
Prydaz Prydaz_chaos_tear chaos_bolt 215279 2867299 136772 12.51 0 655817 4.4 4.4 100.0% 0.0% 0.0% 0.0% 59.32sec 2867299 20.96sec
Prydaz Prydaz_chaos_portal chaos_barrage ticks -187394 5541611 18472 30.85 31291 62592 4.4 154.3 15.4% 0.0% 0.0% 0.0% 58.95sec 5541611 22.84sec
Sephuz Sephuz augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.12sec
Sephuz Sephuz berserking 26297 0 0 0.00 0 0 2.1 0.0 0.0% 0.0% 0.0% 0.0% 180.50sec 0 301.12sec
Sephuz Sephuz chaos_bolt 116858 97765172 324670 22.08 0 882228 58.2 110.8 100.0% 0.0% 0.0% 0.0% 5.02sec 97765172 301.12sec
Sephuz Sephuz conflagrate 17962 32137221 106725 19.00 190266 445611 47.9 95.3 57.5% 0.0% 0.0% 0.0% 6.27sec 32137221 301.12sec
Sephuz Sephuz deadly_grace 188091 1578752 5243 2.83 92251 184602 14.2 14.2 20.6% 0.0% 0.0% 0.0% 2.09sec 1578752 301.12sec
Sephuz Sephuz dimensional_rift 196586 0 0 0.00 0 0 13.1 0.0 0.0% 0.0% 0.0% 0.0% 23.40sec 0 301.12sec
Sephuz Sephuz flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.12sec
Sephuz Sephuz food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.12sec
Sephuz Sephuz havoc 80240 0 0 0.00 0 0 14.9 0.0 0.0% 0.0% 0.0% 0.0% 20.92sec 0 301.12sec
Sephuz Sephuz immolate 348 7656936 25428 7.63 131056 261951 19.8 38.3 52.6% 0.0% 0.0% 0.0% 15.44sec 70000056 301.12sec
Sephuz Sephuz immolate ticks -348 62343121 207810 58.05 140784 281447 19.8 290.2 52.6% 0.0% 0.0% 0.0% 15.44sec 70000056 301.12sec
Sephuz Sephuz incinerate 29722 39520294 131243 29.90 218379 436742 78.2 150.0 20.6% 0.0% 0.0% 0.0% 3.67sec 39520294 301.12sec
Sephuz Sephuz life_tap 1454 0 0 0.00 0 0 7.3 0.0 0.0% 0.0% 0.0% 0.0% 31.33sec 0 301.12sec
Sephuz Sephuz mark_of_the_hidden_satyr 191259 2680715 8902 3.94 112371 224601 19.8 19.8 20.6% 0.0% 0.0% 0.0% 15.14sec 2680715 301.12sec
Sephuz Sephuz potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.12sec
Sephuz Sephuz service_imp 111859 0 0 0.00 0 0 3.7 0.0 0.0% 0.0% 0.0% 0.0% 91.74sec 0 301.12sec
Sephuz Sephuz soul_harvest 196098 0 0 0.00 0 0 2.9 0.0 0.0% 0.0% 0.0% 0.0% 120.89sec 0 301.12sec
Sephuz Sephuz summon_doomguard 18540 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.12sec
Sephuz Sephuz summon_imp 688 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.12sec
Sephuz Sephuz summon_infernal 1122 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.12sec
Sephuz Sephuz_imp firebolt 3110 12738907 42305 21.28 98867 197733 107.6 106.8 20.6% 0.0% 0.0% 0.0% 2.80sec 12738907 301.12sec
Sephuz Sephuz_service_imp firebolt 3110 11716293 122314 30.16 201740 403696 48.4 48.2 20.6% 0.0% 0.0% 0.0% 5.60sec 11716293 95.79sec
Sephuz Sephuz_infernal immolation ticks -19483 2271282 7571 4.62 40722 81444 1.0 23.1 20.6% 0.0% 0.0% 0.0% 0.00sec 2271282 25.00sec
Sephuz Sephuz_infernal melee 0 646615 25864 52.79 24357 48734 22.0 22.0 20.7% 0.0% 0.0% 0.0% 1.12sec 950585 25.00sec
Sephuz Sephuz_doomguard doom_bolt 85692 2347990 93918 25.55 182655 365288 10.6 10.6 20.8% 0.0% 0.0% 0.0% 2.23sec 2347990 25.00sec
Sephuz Sephuz_lord_of_flames_infernal immolation ticks -19483 2270929 7570 4.62 40723 81436 1.0 23.1 20.6% 0.0% 0.0% 0.0% 0.00sec 2270929 25.00sec
Sephuz Sephuz_lord_of_flames_infernal melee 0 646611 25863 52.79 24358 48729 22.0 22.0 20.7% 0.0% 0.0% 0.0% 1.12sec 950580 25.00sec
Sephuz Sephuz_lord_of_flames_infernal immolation ticks -19483 2273654 7579 4.62 40724 81434 1.0 23.1 20.7% 0.0% 0.0% 0.0% 0.00sec 2273654 25.00sec
Sephuz Sephuz_lord_of_flames_infernal melee 0 646398 25855 52.79 24356 48745 22.0 22.0 20.6% 0.0% 0.0% 0.0% 1.12sec 950266 25.00sec
Sephuz Sephuz_lord_of_flames_infernal immolation ticks -19483 2271108 7570 4.62 40720 81459 1.0 23.1 20.6% 0.0% 0.0% 0.0% 0.00sec 2271108 25.00sec
Sephuz Sephuz_lord_of_flames_infernal melee 0 647405 25895 52.79 24359 48716 22.0 22.0 20.8% 0.0% 0.0% 0.0% 1.12sec 951747 25.00sec
Sephuz Sephuz_shadowy_tear shadow_bolt ticks -196657 6186160 20621 9.66 106718 213786 4.4 48.3 20.6% 0.0% 0.0% 0.0% 59.48sec 6186160 51.70sec
Sephuz Sephuz_chaos_tear chaos_bolt 215279 2903329 139489 12.51 0 669114 4.4 4.3 100.0% 0.0% 0.0% 0.0% 59.80sec 2903329 20.81sec
Sephuz Sephuz_chaos_portal chaos_barrage ticks -187394 5592427 18641 30.51 30541 61093 4.4 152.5 20.6% 0.0% 0.0% 0.0% 60.16sec 5592427 22.78sec
Shoulders Shoulders augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.12sec
Shoulders Shoulders berserking 26297 0 0 0.00 0 0 2.1 0.0 0.0% 0.0% 0.0% 0.0% 180.63sec 0 301.12sec
Shoulders Shoulders chaos_bolt 116858 100491668 333724 21.84 0 916824 57.4 109.6 100.0% 0.0% 0.0% 0.0% 5.10sec 100491668 301.12sec
Shoulders Shoulders conflagrate 17962 33738516 112043 19.14 206977 468979 48.3 96.1 55.0% 0.0% 0.0% 0.0% 6.22sec 33738516 301.12sec
Shoulders Shoulders deadly_grace 188091 1604692 5329 2.84 97771 195509 14.2 14.2 15.2% 0.0% 0.0% 0.0% 2.09sec 1604692 301.12sec
Shoulders Shoulders dimensional_rift 196586 0 0 0.00 0 0 13.1 0.0 0.0% 0.0% 0.0% 0.0% 23.34sec 0 301.12sec
Shoulders Shoulders flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.12sec
Shoulders Shoulders food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.12sec
Shoulders Shoulders havoc 80240 0 0 0.00 0 0 14.9 0.0 0.0% 0.0% 0.0% 0.0% 20.91sec 0 301.12sec
Shoulders Shoulders immolate 348 8115958 26952 7.68 142694 285474 19.9 38.6 47.5% 0.0% 0.0% 0.0% 15.28sec 74863015 301.12sec
Shoulders Shoulders immolate ticks -348 66747056 222490 58.59 154454 309122 19.9 293.0 47.4% 0.0% 0.0% 0.0% 15.28sec 74863015 301.12sec
Shoulders Shoulders incinerate 29722 41978226 139406 30.63 236338 472929 80.2 153.7 15.5% 0.0% 0.0% 0.0% 3.59sec 41978226 301.12sec
Shoulders Shoulders life_tap 1454 0 0 0.00 0 0 7.6 0.0 0.0% 0.0% 0.0% 0.0% 30.24sec 0 301.12sec
Shoulders Shoulders mark_of_the_hidden_satyr 191259 2784553 9247 3.97 120766 241565 19.9 19.9 15.6% 0.0% 0.0% 0.0% 15.01sec 2784553 301.12sec
Shoulders Shoulders potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.12sec
Shoulders Shoulders service_imp 111859 0 0 0.00 0 0 3.7 0.0 0.0% 0.0% 0.0% 0.0% 91.86sec 0 301.12sec
Shoulders Shoulders soul_harvest 196098 0 0 0.00 0 0 2.9 0.0 0.0% 0.0% 0.0% 0.0% 120.95sec 0 301.12sec
Shoulders Shoulders summon_doomguard 18540 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.12sec
Shoulders Shoulders summon_imp 688 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.12sec
Shoulders Shoulders summon_infernal 1122 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.12sec
Shoulders Shoulders_imp firebolt 3110 13268505 44064 21.46 106647 213207 108.5 107.7 15.5% 0.0% 0.0% 0.0% 2.77sec 13268505 301.12sec
Shoulders Shoulders_service_imp firebolt 3110 12349614 128921 30.51 219461 438659 49.0 48.7 15.5% 0.0% 0.0% 0.0% 5.55sec 12349614 95.79sec
Shoulders Shoulders_infernal immolation ticks -19483 2443224 8144 4.64 45558 91143 1.0 23.2 15.6% 0.0% 0.0% 0.0% 0.00sec 2443224 25.00sec
Shoulders Shoulders_infernal melee 0 693133 27724 52.83 27269 54543 22.0 22.0 15.5% 0.0% 0.0% 0.0% 1.11sec 1018971 25.00sec
Shoulders Shoulders_doomguard doom_bolt 85692 2441338 97651 26.12 194381 388684 10.9 10.9 15.4% 0.0% 0.0% 0.0% 2.21sec 2441338 25.00sec
Shoulders Shoulders_lord_of_flames_infernal immolation ticks -19483 2441699 8139 4.64 45556 91161 1.0 23.2 15.5% 0.0% 0.0% 0.0% 0.00sec 2441699 25.00sec
Shoulders Shoulders_lord_of_flames_infernal melee 0 692599 27703 52.83 27272 54508 22.0 22.0 15.4% 0.0% 0.0% 0.0% 1.11sec 1018187 25.00sec
Shoulders Shoulders_lord_of_flames_infernal immolation ticks -19483 2441837 8139 4.64 45560 91121 1.0 23.2 15.5% 0.0% 0.0% 0.0% 0.00sec 2441837 25.00sec
Shoulders Shoulders_lord_of_flames_infernal melee 0 693435 27736 52.83 27263 54610 22.0 22.0 15.5% 0.0% 0.0% 0.0% 1.11sec 1019415 25.00sec
Shoulders Shoulders_lord_of_flames_infernal immolation ticks -19483 2438934 8130 4.64 45558 91140 1.0 23.2 15.4% 0.0% 0.0% 0.0% 0.00sec 2438934 25.00sec
Shoulders Shoulders_lord_of_flames_infernal melee 0 693327 27732 52.83 27267 54559 22.0 22.0 15.5% 0.0% 0.0% 0.0% 1.11sec 1019256 25.00sec
Shoulders Shoulders_shadowy_tear shadow_bolt ticks -196657 6680999 22270 9.72 119680 239426 4.4 48.6 15.5% 0.0% 0.0% 0.0% 59.48sec 6680999 57.50sec
Shoulders Shoulders_chaos_tear chaos_bolt 215279 3161107 144082 11.93 0 724919 4.4 4.4 100.0% 0.0% 0.0% 0.0% 58.17sec 3161107 21.94sec
Shoulders Shoulders_chaos_portal chaos_barrage ticks -187394 5976245 19921 30.24 34370 68734 4.4 151.2 15.5% 0.0% 0.0% 0.0% 58.24sec 5976245 23.78sec
Spite Spite augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.12sec
Spite Spite berserking 26297 0 0 0.00 0 0 2.1 0.0 0.0% 0.0% 0.0% 0.0% 180.67sec 0 301.12sec
Spite Spite chaos_bolt 116858 98623309 327519 21.89 0 897534 57.6 109.9 100.0% 0.0% 0.0% 0.0% 5.07sec 98623309 301.12sec
Spite Spite conflagrate 17962 32899186 109255 19.16 200499 456361 48.3 96.1 55.4% 0.0% 0.0% 0.0% 6.21sec 32899186 301.12sec
Spite Spite deadly_grace 188091 1554114 5161 2.85 94012 188234 14.3 14.3 15.7% 0.0% 0.0% 0.0% 2.09sec 1554114 301.12sec
Spite Spite dimensional_rift 196586 0 0 0.00 0 0 13.1 0.0 0.0% 0.0% 0.0% 0.0% 23.21sec 0 301.12sec
Spite Spite flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.12sec
Spite Spite food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.12sec
Spite Spite havoc 80240 0 0 0.00 0 0 14.9 0.0 0.0% 0.0% 0.0% 0.0% 20.91sec 0 301.12sec
Spite Spite immolate 348 7853196 26080 7.69 137650 275544 19.9 38.6 47.7% 0.0% 0.0% 0.0% 15.28sec 73302821 301.12sec
Spite Spite immolate ticks -348 65449625 218165 58.66 151099 302271 19.9 293.3 47.7% 0.0% 0.0% 0.0% 15.28sec 73302821 301.12sec
Spite Spite incinerate 29722 41194019 136802 30.56 232225 464468 80.1 153.4 15.7% 0.0% 0.0% 0.0% 3.58sec 41194019 301.12sec
Spite Spite life_tap 1454 0 0 0.00 0 0 7.6 0.0 0.0% 0.0% 0.0% 0.0% 30.45sec 0 301.12sec
Spite Spite mark_of_the_hidden_satyr 191259 2751696 9138 3.98 119123 238436 20.0 20.0 15.6% 0.0% 0.0% 0.0% 15.02sec 2751696 301.12sec
Spite Spite potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.12sec
Spite Spite service_imp 111859 0 0 0.00 0 0 3.7 0.0 0.0% 0.0% 0.0% 0.0% 91.85sec 0 301.12sec
Spite Spite soul_harvest 196098 0 0 0.00 0 0 2.9 0.0 0.0% 0.0% 0.0% 0.0% 120.90sec 0 301.12sec
Spite Spite summon_doomguard 18540 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.12sec
Spite Spite summon_imp 688 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.12sec
Spite Spite summon_infernal 1122 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.12sec
Spite Spite_imp firebolt 3110 13096355 43492 21.49 105051 210011 108.7 107.8 15.6% 0.0% 0.0% 0.0% 2.77sec 13096355 301.12sec
Spite Spite_service_imp firebolt 3110 12488922 130316 30.55 221334 443039 49.1 48.8 15.6% 0.0% 0.0% 0.0% 5.54sec 12488922 95.84sec
Spite Spite_infernal immolation ticks -19483 2598841 8663 4.65 48303 96637 1.0 23.3 15.7% 0.0% 0.0% 0.0% 0.00sec 2598841 25.00sec
Spite Spite_infernal melee 0 736479 29458 52.84 28922 57850 22.0 22.0 15.7% 0.0% 0.0% 0.0% 1.11sec 1082694 25.00sec
Spite Spite_doomguard doom_bolt 85692 2734844 109391 26.20 216432 432658 10.9 10.9 15.8% 0.0% 0.0% 0.0% 2.20sec 2734844 25.00sec
Spite Spite_lord_of_flames_infernal immolation ticks -19483 2599622 8665 4.65 48307 96600 1.0 23.3 15.7% 0.0% 0.0% 0.0% 0.00sec 2599622 25.00sec
Spite Spite_lord_of_flames_infernal melee 0 736152 29445 52.84 28924 57832 22.0 22.0 15.6% 0.0% 0.0% 0.0% 1.11sec 1082213 25.00sec
Spite Spite_lord_of_flames_infernal immolation ticks -19483 2600348 8668 4.65 48306 96614 1.0 23.3 15.8% 0.0% 0.0% 0.0% 0.00sec 2600348 25.00sec
Spite Spite_lord_of_flames_infernal melee 0 736558 29461 52.84 28920 57880 22.0 22.0 15.7% 0.0% 0.0% 0.0% 1.11sec 1082810 25.00sec
Spite Spite_lord_of_flames_infernal immolation ticks -19483 2597585 8659 4.65 48306 96607 1.0 23.3 15.6% 0.0% 0.0% 0.0% 0.00sec 2597585 25.00sec
Spite Spite_lord_of_flames_infernal melee 0 736615 29463 52.84 28919 57884 22.0 22.0 15.7% 0.0% 0.0% 0.0% 1.11sec 1082893 25.00sec
Spite Spite_shadowy_tear shadow_bolt ticks -196657 6553666 21846 9.75 116939 233565 4.4 48.7 15.7% 0.0% 0.0% 0.0% 59.44sec 6553666 51.93sec
Spite Spite_chaos_tear chaos_bolt 215279 2991709 143361 12.49 0 688424 4.4 4.3 100.0% 0.0% 0.0% 0.0% 59.26sec 2991709 20.87sec
Spite Spite_chaos_portal chaos_barrage ticks -187394 5947758 19826 31.17 33149 66328 4.4 155.9 15.7% 0.0% 0.0% 0.0% 58.65sec 5947758 23.03sec
Warlock_Destruction_T19M Warlock_Destruction_T19M augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.12sec
Warlock_Destruction_T19M Warlock_Destruction_T19M berserking 26297 0 0 0.00 0 0 2.1 0.0 0.0% 0.0% 0.0% 0.0% 180.70sec 0 301.12sec
Warlock_Destruction_T19M Warlock_Destruction_T19M chaos_bolt 116858 93887145 311791 21.93 0 853044 57.6 110.1 100.0% 0.0% 0.0% 0.0% 5.08sec 93887145 301.12sec
Warlock_Destruction_T19M Warlock_Destruction_T19M conflagrate 17962 31650323 105108 19.24 195071 438426 48.6 96.6 54.5% 0.0% 0.0% 0.0% 6.18sec 31650323 301.12sec
Warlock_Destruction_T19M Warlock_Destruction_T19M deadly_grace 188091 1538546 5109 2.84 94593 189257 14.3 14.3 14.0% 0.0% 0.0% 0.0% 2.08sec 1538546 301.12sec
Warlock_Destruction_T19M Warlock_Destruction_T19M dimensional_rift 196586 0 0 0.00 0 0 13.2 0.0 0.0% 0.0% 0.0% 0.0% 23.16sec 0 301.12sec
Warlock_Destruction_T19M Warlock_Destruction_T19M flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.12sec
Warlock_Destruction_T19M Warlock_Destruction_T19M food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.12sec
Warlock_Destruction_T19M Warlock_Destruction_T19M havoc 80240 0 0 0.00 0 0 14.9 0.0 0.0% 0.0% 0.0% 0.0% 20.91sec 0 301.12sec
Warlock_Destruction_T19M Warlock_Destruction_T19M immolate 348 7600154 25239 7.71 134406 269032 20.0 38.7 46.0% 0.0% 0.0% 0.0% 15.16sec 70136059 301.12sec
Warlock_Destruction_T19M Warlock_Destruction_T19M immolate ticks -348 62535905 208453 59.00 145231 290553 20.0 295.0 45.9% 0.0% 0.0% 0.0% 15.16sec 70136059 301.12sec
Warlock_Destruction_T19M Warlock_Destruction_T19M incinerate 29722 39434898 130960 30.84 223480 447338 80.9 154.8 14.0% 0.0% 0.0% 0.0% 3.54sec 39434898 301.12sec
Warlock_Destruction_T19M Warlock_Destruction_T19M life_tap 1454 0 0 0.00 0 0 7.7 0.0 0.0% 0.0% 0.0% 0.0% 30.05sec 0 301.12sec
Warlock_Destruction_T19M Warlock_Destruction_T19M mark_of_the_hidden_satyr 191259 2626075 8721 3.99 115108 230139 20.0 20.0 13.8% 0.0% 0.0% 0.0% 14.88sec 2626075 301.12sec
Warlock_Destruction_T19M Warlock_Destruction_T19M potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.12sec
Warlock_Destruction_T19M Warlock_Destruction_T19M service_imp 111859 0 0 0.00 0 0 3.7 0.0 0.0% 0.0% 0.0% 0.0% 91.86sec 0 301.12sec
Warlock_Destruction_T19M Warlock_Destruction_T19M soul_harvest 196098 0 0 0.00 0 0 2.9 0.0 0.0% 0.0% 0.0% 0.0% 120.84sec 0 301.12sec
Warlock_Destruction_T19M Warlock_Destruction_T19M summon_doomguard 18540 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.12sec
Warlock_Destruction_T19M Warlock_Destruction_T19M summon_imp 688 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.12sec
Warlock_Destruction_T19M Warlock_Destruction_T19M summon_infernal 1122 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.12sec
Warlock_Destruction_T19M Warlock_Destruction_T19M_imp firebolt 3110 12507235 41535 21.59 101305 202632 109.2 108.4 13.9% 0.0% 0.0% 0.0% 2.76sec 12507235 301.12sec
Warlock_Destruction_T19M Warlock_Destruction_T19M_service_imp firebolt 3110 11522960 120275 30.67 206719 413146 49.3 49.0 13.8% 0.0% 0.0% 0.0% 5.53sec 11522960 95.81sec
Warlock_Destruction_T19M Warlock_Destruction_T19M_infernal immolation ticks -19483 2222153 7407 4.66 41809 83598 1.0 23.3 14.0% 0.0% 0.0% 0.0% 0.00sec 2222153 25.00sec
Warlock_Destruction_T19M Warlock_Destruction_T19M_infernal melee 0 629934 25196 52.98 25038 50102 22.1 22.1 13.9% 0.0% 0.0% 0.0% 1.10sec 926063 25.00sec
Warlock_Destruction_T19M Warlock_Destruction_T19M_doomguard doom_bolt 85692 2353640 94142 26.48 187093 374031 11.0 11.0 14.0% 0.0% 0.0% 0.0% 2.19sec 2353640 25.00sec
Warlock_Destruction_T19M Warlock_Destruction_T19M_lord_of_flames_infernal immolation ticks -19483 2221594 7405 4.66 41810 83583 1.0 23.3 13.9% 0.0% 0.0% 0.0% 0.00sec 2221594 25.00sec
Warlock_Destruction_T19M Warlock_Destruction_T19M_lord_of_flames_infernal melee 0 630389 25215 52.98 25039 50097 22.1 22.1 14.0% 0.0% 0.0% 0.0% 1.10sec 926732 25.00sec
Warlock_Destruction_T19M Warlock_Destruction_T19M_lord_of_flames_infernal immolation ticks -19483 2222285 7408 4.66 41808 83608 1.0 23.3 14.0% 0.0% 0.0% 0.0% 0.00sec 2222285 25.00sec
Warlock_Destruction_T19M Warlock_Destruction_T19M_lord_of_flames_infernal melee 0 630033 25200 52.98 25041 50062 22.1 22.1 14.0% 0.0% 0.0% 0.0% 1.10sec 926208 25.00sec
Warlock_Destruction_T19M Warlock_Destruction_T19M_lord_of_flames_infernal immolation ticks -19483 2221614 7405 4.66 41803 83673 1.0 23.3 13.9% 0.0% 0.0% 0.0% 0.00sec 2221614 25.00sec
Warlock_Destruction_T19M Warlock_Destruction_T19M_lord_of_flames_infernal melee 0 629630 25184 52.98 25044 50034 22.1 22.1 13.9% 0.0% 0.0% 0.0% 1.10sec 925615 25.00sec
Warlock_Destruction_T19M Warlock_Destruction_T19M_shadowy_tear shadow_bolt ticks -196657 6098022 20327 9.79 110003 220001 4.4 48.9 13.9% 0.0% 0.0% 0.0% 59.24sec 6098022 51.97sec
Warlock_Destruction_T19M Warlock_Destruction_T19M_chaos_tear chaos_bolt 215279 2830562 135285 12.53 0 647907 4.4 4.4 100.0% 0.0% 0.0% 0.0% 58.42sec 2830562 20.92sec
Warlock_Destruction_T19M Warlock_Destruction_T19M_chaos_portal chaos_barrage ticks -187394 5565340 18551 31.42 31249 62496 4.4 157.1 13.9% 0.0% 0.0% 0.0% 58.36sec 5565340 23.06sec

Fluffy_Pillow : 0 dps, 0 dps to main target

Results, Spec and Gear

RPS Out RPS In Primary Resource Waiting APM Active Skill
0.0 0.0 Mana 0.00% 0.0 100.0% 100%
Talents

Charts

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Health Decade (0 - 10) 1.0 0.0 0.0sec 0.0sec 11.62% 11.62% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (0 - 10)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (0 - 10)_1:11.62%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (10 - 20) 1.0 0.0 0.0sec 0.0sec 10.45% 10.45% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (10 - 20)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (10 - 20)_1:10.45%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (20 - 30) 1.0 0.0 0.0sec 0.0sec 11.83% 11.83% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (20 - 30)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (20 - 30)_1:11.83%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (30 - 40) 1.0 0.0 0.0sec 0.0sec 11.52% 11.52% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (30 - 40)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (30 - 40)_1:11.52%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (40 - 50) 1.0 0.0 0.0sec 0.0sec 11.55% 11.55% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (40 - 50)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (40 - 50)_1:11.55%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (50 - 60) 1.0 0.0 0.0sec 0.0sec 11.55% 11.55% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (50 - 60)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (50 - 60)_1:11.55%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (60 - 70) 1.0 0.0 0.0sec 0.0sec 12.29% 12.29% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (60 - 70)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (60 - 70)_1:12.29%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (70 - 80) 1.0 0.0 0.0sec 0.0sec 9.36% 9.36% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (70 - 80)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (70 - 80)_1:9.36%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (80 - 90) 1.0 0.0 0.0sec 0.0sec 4.55% 4.55% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (80 - 90)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (80 - 90)_1:4.55%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (90 - 100) 1.0 0.0 0.0sec 0.0sec 5.28% 5.28% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (90 - 100)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (90 - 100)_1:5.28%

Trigger Attempt Success

  • trigger_pct:100.00%
Eradication 15.4 42.7 19.8sec 5.2sec 79.60% 79.60% 42.7(42.7) 14.5

Buff details

  • buff initial source:Warlock_Destruction_T19M
  • cooldown name:buff_eradication
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • eradication_1:79.60%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:196414
  • name:Eradication
  • tooltip:Damage taken from the Warlock increased by $s1%.
  • description:{$@spelldesc196412=Chaos Bolt increases the damage you deal to the target by $196414s1% for {$196414d=6 seconds}.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Eradication 15.3 42.6 20.0sec 5.2sec 79.39% 79.39% 42.6(42.6) 14.4

Buff details

  • buff initial source:Prydaz
  • cooldown name:buff_eradication
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • eradication_1:79.39%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:196414
  • name:Eradication
  • tooltip:Damage taken from the Warlock increased by $s1%.
  • description:{$@spelldesc196412=Chaos Bolt increases the damage you deal to the target by $196414s1% for {$196414d=6 seconds}.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Eradication 15.3 42.7 20.0sec 5.2sec 79.67% 79.67% 42.7(42.7) 14.4

Buff details

  • buff initial source:Shoulders
  • cooldown name:buff_eradication
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • eradication_1:79.67%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:196414
  • name:Eradication
  • tooltip:Damage taken from the Warlock increased by $s1%.
  • description:{$@spelldesc196412=Chaos Bolt increases the damage you deal to the target by $196414s1% for {$196414d=6 seconds}.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Eradication 15.3 42.8 20.0sec 5.2sec 79.53% 79.53% 42.8(42.8) 14.4

Buff details

  • buff initial source:Cloak
  • cooldown name:buff_eradication
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • eradication_1:79.53%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:196414
  • name:Eradication
  • tooltip:Damage taken from the Warlock increased by $s1%.
  • description:{$@spelldesc196412=Chaos Bolt increases the damage you deal to the target by $196414s1% for {$196414d=6 seconds}.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Eradication 15.3 42.4 20.0sec 5.2sec 79.21% 79.21% 42.4(42.4) 14.4

Buff details

  • buff initial source:Magistrike
  • cooldown name:buff_eradication
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • eradication_1:79.21%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:196414
  • name:Eradication
  • tooltip:Damage taken from the Warlock increased by $s1%.
  • description:{$@spelldesc196412=Chaos Bolt increases the damage you deal to the target by $196414s1% for {$196414d=6 seconds}.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Eradication 15.3 42.8 20.0sec 5.2sec 79.59% 79.59% 42.8(42.8) 14.4

Buff details

  • buff initial source:Spite
  • cooldown name:buff_eradication
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • eradication_1:79.59%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:196414
  • name:Eradication
  • tooltip:Damage taken from the Warlock increased by $s1%.
  • description:{$@spelldesc196412=Chaos Bolt increases the damage you deal to the target by $196414s1% for {$196414d=6 seconds}.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Eradication 13.2 55.8 23.0sec 4.3sec 85.16% 85.16% 55.8(55.8) 12.3

Buff details

  • buff initial source:Feretory
  • cooldown name:buff_eradication
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • eradication_1:85.16%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:196414
  • name:Eradication
  • tooltip:Damage taken from the Warlock increased by $s1%.
  • description:{$@spelldesc196412=Chaos Bolt increases the damage you deal to the target by $196414s1% for {$196414d=6 seconds}.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Eradication 15.4 40.9 19.8sec 5.3sec 78.26% 78.26% 40.9(40.9) 14.6

Buff details

  • buff initial source:Portal_Pants
  • cooldown name:buff_eradication
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • eradication_1:78.26%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:196414
  • name:Eradication
  • tooltip:Damage taken from the Warlock increased by $s1%.
  • description:{$@spelldesc196412=Chaos Bolt increases the damage you deal to the target by $196414s1% for {$196414d=6 seconds}.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Eradication 15.4 43.1 19.9sec 5.1sec 79.66% 79.66% 43.1(43.1) 14.5

Buff details

  • buff initial source:Norgannon's
  • cooldown name:buff_eradication
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • eradication_1:79.66%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:196414
  • name:Eradication
  • tooltip:Damage taken from the Warlock increased by $s1%.
  • description:{$@spelldesc196412=Chaos Bolt increases the damage you deal to the target by $196414s1% for {$196414d=6 seconds}.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Eradication 15.1 43.8 20.1sec 5.1sec 80.13% 80.13% 43.8(43.8) 14.3

Buff details

  • buff initial source:Alythess'
  • cooldown name:buff_eradication
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • eradication_1:80.13%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:196414
  • name:Eradication
  • tooltip:Damage taken from the Warlock increased by $s1%.
  • description:{$@spelldesc196412=Chaos Bolt increases the damage you deal to the target by $196414s1% for {$196414d=6 seconds}.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Eradication 15.0 43.7 20.3sec 5.1sec 79.93% 79.93% 43.7(43.7) 14.1

Buff details

  • buff initial source:Sephuz
  • cooldown name:buff_eradication
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • eradication_1:79.93%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:196414
  • name:Eradication
  • tooltip:Damage taken from the Warlock increased by $s1%.
  • description:{$@spelldesc196412=Chaos Bolt increases the damage you deal to the target by $196414s1% for {$196414d=6 seconds}.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Eradication 15.2 42.1 20.1sec 5.2sec 78.97% 78.97% 42.1(42.1) 14.3

Buff details

  • buff initial source:KJ_Trinket
  • cooldown name:buff_eradication
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • eradication_1:78.97%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:196414
  • name:Eradication
  • tooltip:Damage taken from the Warlock increased by $s1%.
  • description:{$@spelldesc196412=Chaos Bolt increases the damage you deal to the target by $196414s1% for {$196414d=6 seconds}.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Havoc 0.0 0.0 0.0sec 0.0sec 0.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Cloak
  • cooldown name:buff_havoc
  • max_stacks:1
  • duration:8.00
  • cooldown:20.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • havoc_1:0.00%

Trigger Attempt Success

  • trigger_pct:0.29%

Spelldata details

  • id:80240
  • name:Havoc
  • tooltip:Spells cast by the Warlock also hit this target.
  • description:Marks a target with Havoc for {$d=8 seconds}, causing your single target spells to also strike the Havoc victim. Limit 1.
  • max_stacks:1
  • duration:8.00
  • cooldown:20.00
  • default_chance:101.00%
Roaring Blaze 10.2 38.4 31.2sec 6.2sec 71.91% 70.87% 0.0(0.0) 0.0

Buff details

  • buff initial source:Warlock_Destruction_T19M
  • cooldown name:buff_roaring_blaze
  • max_stacks:100
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • roaring_blaze_1:7.35%
  • roaring_blaze_2:9.30%
  • roaring_blaze_3:10.87%
  • roaring_blaze_4:17.01%
  • roaring_blaze_5:23.93%
  • roaring_blaze_6:3.45%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:205690
  • name:Roaring Blaze
  • tooltip:Damage taken from the Warlock's Immolate increased by $s1%.
  • description:{$@spelldesc205184=Conflagrate increases your remaining Immolate damage on the target by $205690s1% until Immolate expires or is refreshed.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
Roaring Blaze 10.2 37.9 31.4sec 6.2sec 71.47% 70.62% 0.0(0.0) 0.0

Buff details

  • buff initial source:Prydaz
  • cooldown name:buff_roaring_blaze
  • max_stacks:100
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • roaring_blaze_1:7.54%
  • roaring_blaze_2:9.39%
  • roaring_blaze_3:10.81%
  • roaring_blaze_4:17.01%
  • roaring_blaze_5:23.45%
  • roaring_blaze_6:3.26%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:205690
  • name:Roaring Blaze
  • tooltip:Damage taken from the Warlock's Immolate increased by $s1%.
  • description:{$@spelldesc205184=Conflagrate increases your remaining Immolate damage on the target by $205690s1% until Immolate expires or is refreshed.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
Roaring Blaze 10.2 38.1 31.3sec 6.2sec 71.66% 70.73% 0.0(0.0) 0.0

Buff details

  • buff initial source:Shoulders
  • cooldown name:buff_roaring_blaze
  • max_stacks:100
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • roaring_blaze_1:7.48%
  • roaring_blaze_2:9.37%
  • roaring_blaze_3:10.68%
  • roaring_blaze_4:17.17%
  • roaring_blaze_5:23.63%
  • roaring_blaze_6:3.34%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:205690
  • name:Roaring Blaze
  • tooltip:Damage taken from the Warlock's Immolate increased by $s1%.
  • description:{$@spelldesc205184=Conflagrate increases your remaining Immolate damage on the target by $205690s1% until Immolate expires or is refreshed.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
Roaring Blaze 10.2 38.1 31.3sec 6.2sec 71.67% 70.72% 0.0(0.0) 0.0

Buff details

  • buff initial source:Cloak
  • cooldown name:buff_roaring_blaze
  • max_stacks:100
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • roaring_blaze_1:7.47%
  • roaring_blaze_2:9.33%
  • roaring_blaze_3:10.85%
  • roaring_blaze_4:17.00%
  • roaring_blaze_5:23.68%
  • roaring_blaze_6:3.34%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:205690
  • name:Roaring Blaze
  • tooltip:Damage taken from the Warlock's Immolate increased by $s1%.
  • description:{$@spelldesc205184=Conflagrate increases your remaining Immolate damage on the target by $205690s1% until Immolate expires or is refreshed.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
Roaring Blaze 10.1 37.9 31.4sec 6.3sec 71.33% 70.54% 0.0(0.0) 0.0

Buff details

  • buff initial source:Magistrike
  • cooldown name:buff_roaring_blaze
  • max_stacks:100
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • roaring_blaze_1:7.55%
  • roaring_blaze_2:9.45%
  • roaring_blaze_3:10.76%
  • roaring_blaze_4:17.04%
  • roaring_blaze_5:23.31%
  • roaring_blaze_6:3.23%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:205690
  • name:Roaring Blaze
  • tooltip:Damage taken from the Warlock's Immolate increased by $s1%.
  • description:{$@spelldesc205184=Conflagrate increases your remaining Immolate damage on the target by $205690s1% until Immolate expires or is refreshed.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
Roaring Blaze 10.2 38.2 31.3sec 6.2sec 71.72% 70.78% 0.0(0.0) 0.0

Buff details

  • buff initial source:Spite
  • cooldown name:buff_roaring_blaze
  • max_stacks:100
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • roaring_blaze_1:7.44%
  • roaring_blaze_2:9.35%
  • roaring_blaze_3:10.87%
  • roaring_blaze_4:17.01%
  • roaring_blaze_5:23.72%
  • roaring_blaze_6:3.35%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:205690
  • name:Roaring Blaze
  • tooltip:Damage taken from the Warlock's Immolate increased by $s1%.
  • description:{$@spelldesc205184=Conflagrate increases your remaining Immolate damage on the target by $205690s1% until Immolate expires or is refreshed.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
Roaring Blaze 10.2 38.4 31.2sec 6.2sec 71.98% 70.89% 0.0(0.0) 0.0

Buff details

  • buff initial source:Feretory
  • cooldown name:buff_roaring_blaze
  • max_stacks:100
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • roaring_blaze_1:8.42%
  • roaring_blaze_2:9.67%
  • roaring_blaze_3:10.43%
  • roaring_blaze_4:16.22%
  • roaring_blaze_5:23.68%
  • roaring_blaze_6:3.56%
  • roaring_blaze_7:0.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:205690
  • name:Roaring Blaze
  • tooltip:Damage taken from the Warlock's Immolate increased by $s1%.
  • description:{$@spelldesc205184=Conflagrate increases your remaining Immolate damage on the target by $205690s1% until Immolate expires or is refreshed.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
Roaring Blaze 10.0 37.0 31.9sec 6.4sec 70.03% 69.53% 0.0(0.0) 0.0

Buff details

  • buff initial source:Portal_Pants
  • cooldown name:buff_roaring_blaze
  • max_stacks:100
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • roaring_blaze_1:7.83%
  • roaring_blaze_2:9.48%
  • roaring_blaze_3:10.69%
  • roaring_blaze_4:17.10%
  • roaring_blaze_5:22.07%
  • roaring_blaze_6:2.86%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:205690
  • name:Roaring Blaze
  • tooltip:Damage taken from the Warlock's Immolate increased by $s1%.
  • description:{$@spelldesc205184=Conflagrate increases your remaining Immolate damage on the target by $205690s1% until Immolate expires or is refreshed.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
Roaring Blaze 10.2 39.0 31.1sec 6.1sec 72.05% 70.99% 0.0(0.0) 0.0

Buff details

  • buff initial source:Norgannon's
  • cooldown name:buff_roaring_blaze
  • max_stacks:100
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • roaring_blaze_1:7.33%
  • roaring_blaze_2:9.17%
  • roaring_blaze_3:10.70%
  • roaring_blaze_4:16.84%
  • roaring_blaze_5:23.93%
  • roaring_blaze_6:4.08%
  • roaring_blaze_7:0.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:205690
  • name:Roaring Blaze
  • tooltip:Damage taken from the Warlock's Immolate increased by $s1%.
  • description:{$@spelldesc205184=Conflagrate increases your remaining Immolate damage on the target by $205690s1% until Immolate expires or is refreshed.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
Roaring Blaze 10.2 38.2 31.3sec 6.2sec 71.73% 70.79% 0.0(0.0) 0.0

Buff details

  • buff initial source:Alythess'
  • cooldown name:buff_roaring_blaze
  • max_stacks:100
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • roaring_blaze_1:7.49%
  • roaring_blaze_2:9.35%
  • roaring_blaze_3:10.84%
  • roaring_blaze_4:16.94%
  • roaring_blaze_5:23.74%
  • roaring_blaze_6:3.37%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:205690
  • name:Roaring Blaze
  • tooltip:Damage taken from the Warlock's Immolate increased by $s1%.
  • description:{$@spelldesc205184=Conflagrate increases your remaining Immolate damage on the target by $205690s1% until Immolate expires or is refreshed.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
Roaring Blaze 10.1 37.8 31.5sec 6.3sec 71.22% 70.45% 0.0(0.0) 0.0

Buff details

  • buff initial source:Sephuz
  • cooldown name:buff_roaring_blaze
  • max_stacks:100
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • roaring_blaze_1:7.67%
  • roaring_blaze_2:9.50%
  • roaring_blaze_3:10.70%
  • roaring_blaze_4:16.99%
  • roaring_blaze_5:23.15%
  • roaring_blaze_6:3.19%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:205690
  • name:Roaring Blaze
  • tooltip:Damage taken from the Warlock's Immolate increased by $s1%.
  • description:{$@spelldesc205184=Conflagrate increases your remaining Immolate damage on the target by $205690s1% until Immolate expires or is refreshed.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
Roaring Blaze 10.1 37.8 31.5sec 6.3sec 71.26% 70.58% 0.0(0.0) 0.0

Buff details

  • buff initial source:KJ_Trinket
  • cooldown name:buff_roaring_blaze
  • max_stacks:100
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • roaring_blaze_1:7.58%
  • roaring_blaze_2:9.43%
  • roaring_blaze_3:10.74%
  • roaring_blaze_4:17.05%
  • roaring_blaze_5:23.25%
  • roaring_blaze_6:3.20%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:205690
  • name:Roaring Blaze
  • tooltip:Damage taken from the Warlock's Immolate increased by $s1%.
  • description:{$@spelldesc205184=Conflagrate increases your remaining Immolate damage on the target by $205690s1% until Immolate expires or is refreshed.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
bleeding

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_bleeding
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bleeding_1:100.00%
Mortal Wounds

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_mortal_wounds
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.25

Stack Uptimes

  • mortal_wounds_1:100.00%

Spelldata details

  • id:115804
  • name:Mortal Wounds
  • tooltip:Healing effects received reduced by $w1%.
  • description:Grievously wounds the target, reducing the effectiveness of any healing received for {$115804d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%

Procs

Count Interval

Resources

Resource Usage Type Count Total Average RPE APR
Fluffy_Pillow
Resource RPS-Gain RPS-Loss
Health 0.00 7010732.55
Combat End Resource Mean Min Max
Health 0.00 0.00 0.00

Benefits & Uptimes

Benefits %
Uptimes %

Deaths

death count 10136
death count pct 101.33
avg death time 301.11
min death time 221.26
max death time 379.15
dmg taken 2111327047.68

Statistics & Data Analysis

Fight Length
Sample Data Fluffy_Pillow Fight Length
Count 9999
Mean 301.12
Minimum 221.26
Maximum 379.15
Spread ( max - min ) 157.89
Range [ ( max - min ) / 2 * 100% ] 26.22%
DPS
Sample Data Fluffy_Pillow Damage Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Priority Target DPS
Sample Data Fluffy_Pillow Priority Target Damage Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DPS(e)
Sample Data Fluffy_Pillow Damage Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
Sample Data Fluffy_Pillow Damage
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
Sample Data Fluffy_Pillow Damage Taken Per Second
Count 9999
Mean 7035219.16
Minimum 6587400.48
Maximum 7662097.04
Spread ( max - min ) 1074696.56
Range [ ( max - min ) / 2 * 100% ] 7.64%
HPS
Sample Data Fluffy_Pillow Healing Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS(e)
Sample Data Fluffy_Pillow Healing Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Fluffy_Pillow Heal
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Fluffy_Pillow Healing Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Fluffy_Pillow Theck-Meloree Index
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
ETMI
Sample Data Fluffy_PillowTheck-Meloree Index (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data Fluffy_Pillow Max Spike Value
Count 2495
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 snapshot_stats

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0
Agility 0 0 0
Stamina 0 0 0
Intellect 0 0 0
Spirit 0 0 0
Health 0 2530092778 0
Melee Crit 5.00% 5.00% 0
Spell Crit 0.00% 0.00% 0
Haste 0.00% 0.00% 0
Damage / Heal Versatility 0.00% 0.00% 0
Mitigation Versatility 0.00% 0.00% 0
Mastery 0.00% 0.00% 0
Armor 3474 3474 3474
Run Speed 7 0 0
Tank-Miss 3.00% 3.00% 0
Tank-Dodge 3.00% 3.00% 0
Tank-Parry 3.00% 3.00% 0
Tank-Block 3.00% 3.00% 0
Tank-Crit 0.00% 0.00% 0

Gear

Source Slot Average Item Level: 0.00

Talents

Level
15 none none none
30 none none none
45 none none none
60 none none none
75 none none none
90 none none none
100 none none none

Profile

enemy="Fluffy_Pillow"
level=113
race=humanoid
role=tank
position=front
talents=0000000
spec=unknown

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=snapshot_stats

# Executed every time the actor is available.


# Gear Summary
# gear_ilvl=0.00

enemy2 : 0 dps, 0 dps to main target

Results, Spec and Gear

RPS Out RPS In Primary Resource Waiting APM Active Skill
0.0 0.0 Mana 0.00% 0.0 100.0% 100%
Talents

Charts

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Health Decade (0 - 10) 1.0 0.0 0.0sec 0.0sec 8.90% 8.90% 0.0(0.0) 0.0

Buff details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (0 - 10)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (0 - 10)_1:8.90%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (10 - 20) 1.0 0.0 0.0sec 0.0sec 11.63% 11.63% 0.0(0.0) 0.0

Buff details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (10 - 20)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (10 - 20)_1:11.63%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (20 - 30) 1.0 0.0 0.0sec 0.0sec 11.52% 11.52% 0.0(0.0) 0.0

Buff details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (20 - 30)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (20 - 30)_1:11.52%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (30 - 40) 1.0 0.0 0.0sec 0.0sec 11.24% 11.24% 0.0(0.0) 0.0

Buff details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (30 - 40)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (30 - 40)_1:11.24%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (40 - 50) 1.0 0.0 0.0sec 0.0sec 10.73% 10.73% 0.0(0.0) 0.0

Buff details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (40 - 50)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (40 - 50)_1:10.73%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (50 - 60) 1.0 0.0 0.0sec 0.0sec 11.34% 11.34% 0.0(0.0) 0.0

Buff details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (50 - 60)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (50 - 60)_1:11.34%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (60 - 70) 1.0 0.0 0.0sec 0.0sec 11.85% 11.85% 0.0(0.0) 0.0

Buff details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (60 - 70)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (60 - 70)_1:11.85%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (70 - 80) 1.0 0.0 0.0sec 0.0sec 10.04% 10.04% 0.0(0.0) 0.0

Buff details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (70 - 80)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (70 - 80)_1:10.04%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (80 - 90) 1.0 0.0 0.0sec 0.0sec 6.31% 6.31% 0.0(0.0) 0.0

Buff details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (80 - 90)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (80 - 90)_1:6.31%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (90 - 100) 1.0 0.0 0.0sec 0.0sec 6.44% 6.44% 0.0(0.0) 0.0

Buff details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (90 - 100)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (90 - 100)_1:6.44%

Trigger Attempt Success

  • trigger_pct:100.00%
Eradication 15.0 36.9 19.7sec 5.6sec 72.50% 72.50% 36.9(36.9) 14.2

Buff details

  • buff initial source:Warlock_Destruction_T19M
  • cooldown name:buff_eradication
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • eradication_1:72.50%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:196414
  • name:Eradication
  • tooltip:Damage taken from the Warlock increased by $s1%.
  • description:{$@spelldesc196412=Chaos Bolt increases the damage you deal to the target by $196414s1% for {$196414d=6 seconds}.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Eradication 15.0 36.4 19.7sec 5.6sec 71.98% 71.98% 36.4(36.4) 14.2

Buff details

  • buff initial source:Prydaz
  • cooldown name:buff_eradication
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • eradication_1:71.98%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:196414
  • name:Eradication
  • tooltip:Damage taken from the Warlock increased by $s1%.
  • description:{$@spelldesc196412=Chaos Bolt increases the damage you deal to the target by $196414s1% for {$196414d=6 seconds}.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Eradication 14.9 36.7 19.8sec 5.6sec 72.36% 72.36% 36.7(36.7) 14.1

Buff details

  • buff initial source:Shoulders
  • cooldown name:buff_eradication
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • eradication_1:72.36%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:196414
  • name:Eradication
  • tooltip:Damage taken from the Warlock increased by $s1%.
  • description:{$@spelldesc196412=Chaos Bolt increases the damage you deal to the target by $196414s1% for {$196414d=6 seconds}.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Eradication 15.0 36.7 19.7sec 5.6sec 72.21% 72.21% 36.7(36.7) 14.2

Buff details

  • buff initial source:Cloak
  • cooldown name:buff_eradication
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • eradication_1:72.21%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:196414
  • name:Eradication
  • tooltip:Damage taken from the Warlock increased by $s1%.
  • description:{$@spelldesc196412=Chaos Bolt increases the damage you deal to the target by $196414s1% for {$196414d=6 seconds}.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Eradication 15.0 36.2 19.7sec 5.7sec 71.78% 71.78% 36.2(36.2) 14.2

Buff details

  • buff initial source:Magistrike
  • cooldown name:buff_eradication
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • eradication_1:71.78%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:196414
  • name:Eradication
  • tooltip:Damage taken from the Warlock increased by $s1%.
  • description:{$@spelldesc196412=Chaos Bolt increases the damage you deal to the target by $196414s1% for {$196414d=6 seconds}.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Eradication 15.0 36.8 19.7sec 5.6sec 72.30% 72.30% 36.8(36.8) 14.2

Buff details

  • buff initial source:Spite
  • cooldown name:buff_eradication
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • eradication_1:72.30%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:196414
  • name:Eradication
  • tooltip:Damage taken from the Warlock increased by $s1%.
  • description:{$@spelldesc196412=Chaos Bolt increases the damage you deal to the target by $196414s1% for {$196414d=6 seconds}.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Eradication 13.2 49.2 22.4sec 4.6sec 78.90% 78.90% 49.2(49.2) 12.3

Buff details

  • buff initial source:Feretory
  • cooldown name:buff_eradication
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • eradication_1:78.90%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:196414
  • name:Eradication
  • tooltip:Damage taken from the Warlock increased by $s1%.
  • description:{$@spelldesc196412=Chaos Bolt increases the damage you deal to the target by $196414s1% for {$196414d=6 seconds}.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Eradication 15.2 34.9 19.5sec 5.8sec 71.06% 71.06% 34.9(34.9) 14.4

Buff details

  • buff initial source:Portal_Pants
  • cooldown name:buff_eradication
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • eradication_1:71.06%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:196414
  • name:Eradication
  • tooltip:Damage taken from the Warlock increased by $s1%.
  • description:{$@spelldesc196412=Chaos Bolt increases the damage you deal to the target by $196414s1% for {$196414d=6 seconds}.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Eradication 15.0 38.0 19.8sec 5.5sec 73.27% 73.27% 38.0(38.0) 14.1

Buff details

  • buff initial source:Norgannon's
  • cooldown name:buff_eradication
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • eradication_1:73.27%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:196414
  • name:Eradication
  • tooltip:Damage taken from the Warlock increased by $s1%.
  • description:{$@spelldesc196412=Chaos Bolt increases the damage you deal to the target by $196414s1% for {$196414d=6 seconds}.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Eradication 14.9 37.7 19.9sec 5.5sec 72.90% 72.90% 37.7(37.7) 14.1

Buff details

  • buff initial source:Alythess'
  • cooldown name:buff_eradication
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • eradication_1:72.90%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:196414
  • name:Eradication
  • tooltip:Damage taken from the Warlock increased by $s1%.
  • description:{$@spelldesc196412=Chaos Bolt increases the damage you deal to the target by $196414s1% for {$196414d=6 seconds}.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Eradication 14.9 37.3 19.9sec 5.6sec 72.54% 72.54% 37.3(37.3) 14.0

Buff details

  • buff initial source:Sephuz
  • cooldown name:buff_eradication
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • eradication_1:72.54%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:196414
  • name:Eradication
  • tooltip:Damage taken from the Warlock increased by $s1%.
  • description:{$@spelldesc196412=Chaos Bolt increases the damage you deal to the target by $196414s1% for {$196414d=6 seconds}.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Eradication 15.0 35.8 19.7sec 5.7sec 71.47% 71.47% 35.8(35.8) 14.2

Buff details

  • buff initial source:KJ_Trinket
  • cooldown name:buff_eradication
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • eradication_1:71.47%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:196414
  • name:Eradication
  • tooltip:Damage taken from the Warlock increased by $s1%.
  • description:{$@spelldesc196412=Chaos Bolt increases the damage you deal to the target by $196414s1% for {$196414d=6 seconds}.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Havoc 14.9 0.0 20.9sec 20.9sec 95.89% 95.89% 0.0(0.0) 13.9

Buff details

  • buff initial source:Warlock_Destruction_T19M
  • cooldown name:buff_havoc
  • max_stacks:1
  • duration:8.00
  • cooldown:20.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • havoc_1:95.89%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:80240
  • name:Havoc
  • tooltip:Spells cast by the Warlock also hit this target.
  • description:Marks a target with Havoc for {$d=8 seconds}, causing your single target spells to also strike the Havoc victim. Limit 1.
  • max_stacks:1
  • duration:8.00
  • cooldown:20.00
  • default_chance:101.00%
Havoc 14.9 0.0 20.9sec 20.9sec 95.85% 95.85% 0.0(0.0) 13.9

Buff details

  • buff initial source:Prydaz
  • cooldown name:buff_havoc
  • max_stacks:1
  • duration:8.00
  • cooldown:20.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • havoc_1:95.85%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:80240
  • name:Havoc
  • tooltip:Spells cast by the Warlock also hit this target.
  • description:Marks a target with Havoc for {$d=8 seconds}, causing your single target spells to also strike the Havoc victim. Limit 1.
  • max_stacks:1
  • duration:8.00
  • cooldown:20.00
  • default_chance:101.00%
Havoc 14.9 0.0 20.9sec 20.9sec 95.90% 95.90% 0.0(0.0) 14.0

Buff details

  • buff initial source:Shoulders
  • cooldown name:buff_havoc
  • max_stacks:1
  • duration:8.00
  • cooldown:20.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • havoc_1:95.90%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:80240
  • name:Havoc
  • tooltip:Spells cast by the Warlock also hit this target.
  • description:Marks a target with Havoc for {$d=8 seconds}, causing your single target spells to also strike the Havoc victim. Limit 1.
  • max_stacks:1
  • duration:8.00
  • cooldown:20.00
  • default_chance:101.00%
Havoc 14.9 0.0 20.9sec 20.9sec 95.88% 95.88% 0.0(0.0) 13.9

Buff details

  • buff initial source:Cloak
  • cooldown name:buff_havoc
  • max_stacks:1
  • duration:8.00
  • cooldown:20.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • havoc_1:95.88%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:80240
  • name:Havoc
  • tooltip:Spells cast by the Warlock also hit this target.
  • description:Marks a target with Havoc for {$d=8 seconds}, causing your single target spells to also strike the Havoc victim. Limit 1.
  • max_stacks:1
  • duration:8.00
  • cooldown:20.00
  • default_chance:101.00%
Havoc 14.9 0.0 20.9sec 20.9sec 95.83% 95.83% 0.0(0.0) 13.9

Buff details

  • buff initial source:Magistrike
  • cooldown name:buff_havoc
  • max_stacks:1
  • duration:8.00
  • cooldown:20.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • havoc_1:95.83%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:80240
  • name:Havoc
  • tooltip:Spells cast by the Warlock also hit this target.
  • description:Marks a target with Havoc for {$d=8 seconds}, causing your single target spells to also strike the Havoc victim. Limit 1.
  • max_stacks:1
  • duration:8.00
  • cooldown:20.00
  • default_chance:101.00%
Havoc 14.9 0.0 20.9sec 20.9sec 95.88% 95.88% 0.0(0.0) 13.9

Buff details

  • buff initial source:Spite
  • cooldown name:buff_havoc
  • max_stacks:1
  • duration:8.00
  • cooldown:20.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • havoc_1:95.88%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:80240
  • name:Havoc
  • tooltip:Spells cast by the Warlock also hit this target.
  • description:Marks a target with Havoc for {$d=8 seconds}, causing your single target spells to also strike the Havoc victim. Limit 1.
  • max_stacks:1
  • duration:8.00
  • cooldown:20.00
  • default_chance:101.00%
Havoc 14.9 0.0 20.9sec 20.9sec 96.03% 96.03% 0.0(0.0) 14.0

Buff details

  • buff initial source:Feretory
  • cooldown name:buff_havoc
  • max_stacks:1
  • duration:8.00
  • cooldown:20.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • havoc_1:96.03%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:80240
  • name:Havoc
  • tooltip:Spells cast by the Warlock also hit this target.
  • description:Marks a target with Havoc for {$d=8 seconds}, causing your single target spells to also strike the Havoc victim. Limit 1.
  • max_stacks:1
  • duration:8.00
  • cooldown:20.00
  • default_chance:101.00%
Havoc 14.9 0.0 20.9sec 20.9sec 95.64% 95.64% 0.0(0.0) 13.9

Buff details

  • buff initial source:Portal_Pants
  • cooldown name:buff_havoc
  • max_stacks:1
  • duration:8.00
  • cooldown:20.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • havoc_1:95.64%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:80240
  • name:Havoc
  • tooltip:Spells cast by the Warlock also hit this target.
  • description:Marks a target with Havoc for {$d=8 seconds}, causing your single target spells to also strike the Havoc victim. Limit 1.
  • max_stacks:1
  • duration:8.00
  • cooldown:20.00
  • default_chance:101.00%
Havoc 14.9 0.0 20.9sec 20.9sec 95.90% 95.90% 0.0(0.0) 13.9

Buff details

  • buff initial source:Norgannon's
  • cooldown name:buff_havoc
  • max_stacks:1
  • duration:8.00
  • cooldown:20.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • havoc_1:95.90%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:80240
  • name:Havoc
  • tooltip:Spells cast by the Warlock also hit this target.
  • description:Marks a target with Havoc for {$d=8 seconds}, causing your single target spells to also strike the Havoc victim. Limit 1.
  • max_stacks:1
  • duration:8.00
  • cooldown:20.00
  • default_chance:101.00%
Havoc 14.9 0.0 20.9sec 20.9sec 95.88% 95.88% 0.0(0.0) 13.9

Buff details

  • buff initial source:Alythess'
  • cooldown name:buff_havoc
  • max_stacks:1
  • duration:8.00
  • cooldown:20.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • havoc_1:95.88%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:80240
  • name:Havoc
  • tooltip:Spells cast by the Warlock also hit this target.
  • description:Marks a target with Havoc for {$d=8 seconds}, causing your single target spells to also strike the Havoc victim. Limit 1.
  • max_stacks:1
  • duration:8.00
  • cooldown:20.00
  • default_chance:101.00%
Havoc 14.9 0.0 20.9sec 20.9sec 95.85% 95.85% 0.0(0.0) 13.9

Buff details

  • buff initial source:Sephuz
  • cooldown name:buff_havoc
  • max_stacks:1
  • duration:8.00
  • cooldown:20.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • havoc_1:95.85%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:80240
  • name:Havoc
  • tooltip:Spells cast by the Warlock also hit this target.
  • description:Marks a target with Havoc for {$d=8 seconds}, causing your single target spells to also strike the Havoc victim. Limit 1.
  • max_stacks:1
  • duration:8.00
  • cooldown:20.00
  • default_chance:101.00%
Havoc 14.9 0.0 20.9sec 20.9sec 95.78% 95.78% 0.0(0.0) 13.9

Buff details

  • buff initial source:KJ_Trinket
  • cooldown name:buff_havoc
  • max_stacks:1
  • duration:8.00
  • cooldown:20.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • havoc_1:95.78%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:80240
  • name:Havoc
  • tooltip:Spells cast by the Warlock also hit this target.
  • description:Marks a target with Havoc for {$d=8 seconds}, causing your single target spells to also strike the Havoc victim. Limit 1.
  • max_stacks:1
  • duration:8.00
  • cooldown:20.00
  • default_chance:101.00%
Roaring Blaze 10.5 37.4 30.1sec 6.3sec 71.05% 70.71% 0.0(0.0) 0.0

Buff details

  • buff initial source:Warlock_Destruction_T19M
  • cooldown name:buff_roaring_blaze
  • max_stacks:100
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • roaring_blaze_1:8.21%
  • roaring_blaze_2:9.81%
  • roaring_blaze_3:10.67%
  • roaring_blaze_4:16.50%
  • roaring_blaze_5:22.44%
  • roaring_blaze_6:3.43%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:205690
  • name:Roaring Blaze
  • tooltip:Damage taken from the Warlock's Immolate increased by $s1%.
  • description:{$@spelldesc205184=Conflagrate increases your remaining Immolate damage on the target by $205690s1% until Immolate expires or is refreshed.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
Roaring Blaze 10.4 37.1 30.5sec 6.3sec 70.76% 70.51% 0.0(0.0) 0.0

Buff details

  • buff initial source:Prydaz
  • cooldown name:buff_roaring_blaze
  • max_stacks:100
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • roaring_blaze_1:8.18%
  • roaring_blaze_2:9.81%
  • roaring_blaze_3:10.65%
  • roaring_blaze_4:16.64%
  • roaring_blaze_5:22.25%
  • roaring_blaze_6:3.24%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:205690
  • name:Roaring Blaze
  • tooltip:Damage taken from the Warlock's Immolate increased by $s1%.
  • description:{$@spelldesc205184=Conflagrate increases your remaining Immolate damage on the target by $205690s1% until Immolate expires or is refreshed.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
Roaring Blaze 10.4 37.3 30.4sec 6.3sec 70.92% 70.61% 0.0(0.0) 0.0

Buff details

  • buff initial source:Shoulders
  • cooldown name:buff_roaring_blaze
  • max_stacks:100
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • roaring_blaze_1:8.17%
  • roaring_blaze_2:9.81%
  • roaring_blaze_3:10.52%
  • roaring_blaze_4:16.76%
  • roaring_blaze_5:22.35%
  • roaring_blaze_6:3.31%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:205690
  • name:Roaring Blaze
  • tooltip:Damage taken from the Warlock's Immolate increased by $s1%.
  • description:{$@spelldesc205184=Conflagrate increases your remaining Immolate damage on the target by $205690s1% until Immolate expires or is refreshed.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
Roaring Blaze 10.5 37.3 30.3sec 6.3sec 70.90% 70.59% 0.0(0.0) 0.0

Buff details

  • buff initial source:Cloak
  • cooldown name:buff_roaring_blaze
  • max_stacks:100
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • roaring_blaze_1:8.20%
  • roaring_blaze_2:9.81%
  • roaring_blaze_3:10.66%
  • roaring_blaze_4:16.56%
  • roaring_blaze_5:22.36%
  • roaring_blaze_6:3.32%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:205690
  • name:Roaring Blaze
  • tooltip:Damage taken from the Warlock's Immolate increased by $s1%.
  • description:{$@spelldesc205184=Conflagrate increases your remaining Immolate damage on the target by $205690s1% until Immolate expires or is refreshed.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
Roaring Blaze 10.4 37.0 30.6sec 6.3sec 70.64% 70.43% 0.0(0.0) 0.0

Buff details

  • buff initial source:Magistrike
  • cooldown name:buff_roaring_blaze
  • max_stacks:100
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • roaring_blaze_1:8.14%
  • roaring_blaze_2:9.85%
  • roaring_blaze_3:10.61%
  • roaring_blaze_4:16.69%
  • roaring_blaze_5:22.14%
  • roaring_blaze_6:3.21%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:205690
  • name:Roaring Blaze
  • tooltip:Damage taken from the Warlock's Immolate increased by $s1%.
  • description:{$@spelldesc205184=Conflagrate increases your remaining Immolate damage on the target by $205690s1% until Immolate expires or is refreshed.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
Roaring Blaze 10.5 37.3 30.3sec 6.3sec 70.94% 70.63% 0.0(0.0) 0.0

Buff details

  • buff initial source:Spite
  • cooldown name:buff_roaring_blaze
  • max_stacks:100
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • roaring_blaze_1:8.18%
  • roaring_blaze_2:9.82%
  • roaring_blaze_3:10.66%
  • roaring_blaze_4:16.57%
  • roaring_blaze_5:22.38%
  • roaring_blaze_6:3.33%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:205690
  • name:Roaring Blaze
  • tooltip:Damage taken from the Warlock's Immolate increased by $s1%.
  • description:{$@spelldesc205184=Conflagrate increases your remaining Immolate damage on the target by $205690s1% until Immolate expires or is refreshed.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
Roaring Blaze 10.6 37.5 30.0sec 6.2sec 71.08% 70.73% 0.0(0.0) 0.0

Buff details

  • buff initial source:Feretory
  • cooldown name:buff_roaring_blaze
  • max_stacks:100
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • roaring_blaze_1:9.21%
  • roaring_blaze_2:10.20%
  • roaring_blaze_3:10.21%
  • roaring_blaze_4:15.70%
  • roaring_blaze_5:22.22%
  • roaring_blaze_6:3.54%
  • roaring_blaze_7:0.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:205690
  • name:Roaring Blaze
  • tooltip:Damage taken from the Warlock's Immolate increased by $s1%.
  • description:{$@spelldesc205184=Conflagrate increases your remaining Immolate damage on the target by $205690s1% until Immolate expires or is refreshed.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
Roaring Blaze 10.3 36.0 30.9sec 6.5sec 69.36% 69.58% 0.0(0.0) 0.0

Buff details

  • buff initial source:Portal_Pants
  • cooldown name:buff_roaring_blaze
  • max_stacks:100
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • roaring_blaze_1:8.55%
  • roaring_blaze_2:9.95%
  • roaring_blaze_3:10.71%
  • roaring_blaze_4:16.61%
  • roaring_blaze_5:20.69%
  • roaring_blaze_6:2.85%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:205690
  • name:Roaring Blaze
  • tooltip:Damage taken from the Warlock's Immolate increased by $s1%.
  • description:{$@spelldesc205184=Conflagrate increases your remaining Immolate damage on the target by $205690s1% until Immolate expires or is refreshed.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
Roaring Blaze 10.7 37.8 29.7sec 6.2sec 71.05% 70.86% 0.0(0.0) 0.0

Buff details

  • buff initial source:Norgannon's
  • cooldown name:buff_roaring_blaze
  • max_stacks:100
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • roaring_blaze_1:8.51%
  • roaring_blaze_2:9.67%
  • roaring_blaze_3:10.49%
  • roaring_blaze_4:16.28%
  • roaring_blaze_5:22.05%
  • roaring_blaze_6:4.05%
  • roaring_blaze_7:0.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:205690
  • name:Roaring Blaze
  • tooltip:Damage taken from the Warlock's Immolate increased by $s1%.
  • description:{$@spelldesc205184=Conflagrate increases your remaining Immolate damage on the target by $205690s1% until Immolate expires or is refreshed.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
Roaring Blaze 10.5 37.3 30.3sec 6.3sec 70.91% 70.63% 0.0(0.0) 0.0

Buff details

  • buff initial source:Alythess'
  • cooldown name:buff_roaring_blaze
  • max_stacks:100
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • roaring_blaze_1:8.26%
  • roaring_blaze_2:9.81%
  • roaring_blaze_3:10.64%
  • roaring_blaze_4:16.48%
  • roaring_blaze_5:22.37%
  • roaring_blaze_6:3.35%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:205690
  • name:Roaring Blaze
  • tooltip:Damage taken from the Warlock's Immolate increased by $s1%.
  • description:{$@spelldesc205184=Conflagrate increases your remaining Immolate damage on the target by $205690s1% until Immolate expires or is refreshed.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
Roaring Blaze 10.4 37.0 30.7sec 6.3sec 70.56% 70.36% 0.0(0.0) 0.0

Buff details

  • buff initial source:Sephuz
  • cooldown name:buff_roaring_blaze
  • max_stacks:100
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • roaring_blaze_1:8.23%
  • roaring_blaze_2:9.88%
  • roaring_blaze_3:10.56%
  • roaring_blaze_4:16.66%
  • roaring_blaze_5:22.05%
  • roaring_blaze_6:3.18%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:205690
  • name:Roaring Blaze
  • tooltip:Damage taken from the Warlock's Immolate increased by $s1%.
  • description:{$@spelldesc205184=Conflagrate increases your remaining Immolate damage on the target by $205690s1% until Immolate expires or is refreshed.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
Roaring Blaze 10.4 37.0 30.7sec 6.3sec 70.62% 70.53% 0.0(0.0) 0.0

Buff details

  • buff initial source:KJ_Trinket
  • cooldown name:buff_roaring_blaze
  • max_stacks:100
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • roaring_blaze_1:8.15%
  • roaring_blaze_2:9.86%
  • roaring_blaze_3:10.61%
  • roaring_blaze_4:16.73%
  • roaring_blaze_5:22.10%
  • roaring_blaze_6:3.18%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:205690
  • name:Roaring Blaze
  • tooltip:Damage taken from the Warlock's Immolate increased by $s1%.
  • description:{$@spelldesc205184=Conflagrate increases your remaining Immolate damage on the target by $205690s1% until Immolate expires or is refreshed.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
bleeding

Buff details

  • buff initial source:enemy2
  • cooldown name:buff_bleeding
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bleeding_1:100.00%
Mortal Wounds

Buff details

  • buff initial source:enemy2
  • cooldown name:buff_mortal_wounds
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.25

Stack Uptimes

  • mortal_wounds_1:100.00%

Spelldata details

  • id:115804
  • name:Mortal Wounds
  • tooltip:Healing effects received reduced by $w1%.
  • description:Grievously wounds the target, reducing the effectiveness of any healing received for {$115804d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%

Procs

Count Interval

Resources

Resource Usage Type Count Total Average RPE APR
enemy2
Resource RPS-Gain RPS-Loss
Health 0.00 4969169.03
Combat End Resource Mean Min Max
Health 31037658.25 0.00 86253178.51

Benefits & Uptimes

Benefits %
Uptimes %

Deaths

death count 487
death count pct 4.87
avg death time 308.31
min death time 254.06
max death time 376.03
dmg taken 1495967718.24

Statistics & Data Analysis

Fight Length
Sample Data enemy2 Fight Length
Count 9999
Mean 301.05
Minimum 221.26
Maximum 379.15
Spread ( max - min ) 157.89
Range [ ( max - min ) / 2 * 100% ] 26.22%
DPS
Sample Data enemy2 Damage Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Priority Target DPS
Sample Data enemy2 Priority Target Damage Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DPS(e)
Sample Data enemy2 Damage Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
Sample Data enemy2 Damage
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
Sample Data enemy2 Damage Taken Per Second
Count 9999
Mean 4981320.96
Minimum 4673601.42
Maximum 5356298.80
Spread ( max - min ) 682697.38
Range [ ( max - min ) / 2 * 100% ] 6.85%
HPS
Sample Data enemy2 Healing Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS(e)
Sample Data enemy2 Healing Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data enemy2 Heal
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data enemy2 Healing Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data enemy2 Theck-Meloree Index
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
ETMI
Sample Data enemy2Theck-Meloree Index (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data enemy2 Max Spike Value
Count 2495
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 snapshot_stats

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0
Agility 0 0 0
Stamina 0 0 0
Intellect 0 0 0
Spirit 0 0 0
Health 0 1848770071 0
Melee Crit 5.00% 5.00% 0
Spell Crit 0.00% 0.00% 0
Haste 0.00% 0.00% 0
Damage / Heal Versatility 0.00% 0.00% 0
Mitigation Versatility 0.00% 0.00% 0
Mastery 0.00% 0.00% 0
Armor 3474 3474 3474
Run Speed 7 0 0
Tank-Miss 3.00% 3.00% 0
Tank-Dodge 3.00% 3.00% 0
Tank-Parry 3.00% 3.00% 0
Tank-Block 3.00% 3.00% 0
Tank-Crit 0.00% 0.00% 0

Gear

Source Slot Average Item Level: 0.00

Talents

Level
15 none none none
30 none none none
45 none none none
60 none none none
75 none none none
90 none none none
100 none none none

Profile

enemy="enemy2"
level=113
race=humanoid
role=tank
position=front
talents=0000000
spec=unknown

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=snapshot_stats

# Executed every time the actor is available.


# Gear Summary
# gear_ilvl=0.00

APM

Average number of actions executed per minute.

APS

Average absorption per active player duration.

Constant Buffs

Buffs received prior to combat and present the entire fight.

Count

Average number of times an action is executed per iteration.

Crit

Average crit damage.

Crit%

Percentage of executes that resulted in critical strikes.

DPE

Average damage per execution of an individual action.

DPET

Average damage per execute time of an individual action; the amount of damage generated, divided by the time taken to execute the action, including time spent in the GCD.

DPR

Average damage per resource point spent.

DPS

Average damage per active player duration.

DPSE

Average damage per fight duration.

DTPS

Average damage taken per second per active player duration.

HPS

Average healing (and absorption) per active player duration.

HPSE

Average healing (and absorption) per fight duration.

HPE

Average healing (or absorb) per execution of an individual action.

HPET

Average healing (or absorb) per execute time of an individual action; the amount of healing generated, divided by the time taken to execute the action, including time spent in the GCD.

HPR

Average healing (or absorb) per resource point spent.

Impacts

Average number of impacts against a target (for attacks that hit multiple times per execute) per iteration.

Dodge%

Percentage of executes that resulted in dodges.

DPS%

Percentage of total DPS contributed by a particular action.

HPS%

Percentage of total HPS (including absorb) contributed by a particular action.

Theck-Meloree Index

Measure of damage smoothness, calculated over entire fight length. Related to max spike damage, 1k TMI is roughly equivalent to 1% of your health. TMI ignores external healing and absorbs. Lower is better.

TMI bin size

Time bin size used to calculate TMI and MSD, in seconds.

Type

Direct or Periodic damage.

Max Spike Damage Frequency

This is roughly how many spikes as large as MSD Mean you take per iteration. Calculated from TMI and MSD values.

Dynamic Buffs

Temporary buffs received during combat, perhaps multiple times.

Glance%

Percentage of executes that resulted in glancing blows.

Block%

Percentage of executes that resulted in blocking blows.

Id

Associated spell-id for this ability.

Ability

Name of the ability.

Total

Total damage for this ability during the fight.

Hit

Average non-crit damage.

Interval

Average time between executions of a particular action.

Avg

Average direct damage per execution.

Miss%

Percentage of executes that resulted in misses, dodges or parries.

Origin

The player profile from which the simulation script was generated. The profile must be copied into the same directory as this HTML file in order for the link to work.

Parry%

Percentage of executes that resulted in parries.

RPS In

Average primary resource points generated per second.

RPS Out

Average primary resource points consumed per second.

Scale Factors

Gain per unit stat increase except for Hit/Expertise which represent Loss per unit stat decrease.

Gear Amount

Amount from raw gear, before class, attunement, or buff modifiers. Amount from hybrid primary stats (i.e. Agility/Intellect) shown in parentheses.

Stats Raid Buffed

Amount after all static buffs have been accounted for. Dynamic buffs (i.e. trinkets, potions) not included.

Stats Unbuffed

Amount after class modifiers and effects, but before buff modifiers.

Ticks

Average number of periodic ticks per iteration. Spells that do not have a damage-over-time component will have zero ticks.

Ticks Crit

Average crit tick damage.

Ticks Crit%

Percentage of ticks that resulted in critical strikes.

Ticks Hit

Average non-crit tick damage.

Ticks Miss%

Percentage of ticks that resulted in misses, dodges or parries.

Ticks Uptime%

Percentage of total time that DoT is ticking on target.

Ticks Avg

Average damage per tick.

Timeline Distribution

The simulated encounter's duration can vary based on the health of the target and variation in the raid DPS. This chart shows how often the duration of the encounter varied by how much time.

Waiting

This is the percentage of time in which no action can be taken other than autoattacks. This can be caused by resource starvation, lockouts, and timers.

Scale Factor Ranking

This row ranks the scale factors from highest to lowest, checking whether one scale factor is higher/lower than another with statistical significance.

TMI Range

This is the range of TMI values containing 95.00% of the data, roughly centered on the mean.

TMI/MSD Window

Window length used to calculate TMI and MSD, in seconds.

Max Spike Damage

Maximum amount of net damage taken in any N-second period (default 6sec), expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Error

Estimator for the 95.00% confidence interval.

Range

This is the range of values containing 95.00% of the data, roughly centered on the mean.

Fight Length

Fight Length: 300.00
Vary Combat Length: 0.20

Fight Length is the specified average fight duration. If vary_combat_length is set, the fight length will vary by +/- that portion of the value. See Combat Length in the wiki for further details.